KEGG   Homo sapiens (human): 5862
Entry
5862              CDS       T01001                                 

Gene name
RAB2A, LHX, RAB2
Definition
(RefSeq) RAB2A, member RAS oncogene family
  KO
K07877  Ras-related protein Rab-2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    5862 (RAB2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5862 (RAB2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5862 (RAB2A)
   04031 GTP-binding proteins [BR:hsa04031]
    5862 (RAB2A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    5862 (RAB2A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5862 (RAB2A)
  Exosomal proteins of other body fluids (saliva and urine)
   5862 (RAB2A)
  Exosomal proteins of colorectal cancer cells
   5862 (RAB2A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    5862 (RAB2A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3
Other DBs
NCBI-GeneID: 5862
NCBI-ProteinID: NP_002856
OMIM: 179509
HGNC: 9763
Ensembl: ENSG00000104388
Vega: OTTHUMG00000134298
Pharos: P61019(Tbio)
UniProt: P61019 A0A024R7V6
Structure
PDB: 
1Z0A

Position
8q12.1-q12.2
AA seq 212 aa
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNATHAGNQGGQQAGGGCC
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgtacgcctatctcttcaagtacatcataatcggcgacacaggtgttggtaaatca
tgcttattgctacagtttacagacaagaggtttcagccagtgcatgaccttactattggt
gtagagttcggtgctcgaatgataactattgatgggaaacagataaaacttcagatatgg
gatacggcagggcaagaatcctttcgttccatcacaaggtcgtattacagaggtgcagca
ggagctttactagtttacgatattacacggagagatacattcaaccacttgacaacctgg
ttagaagatgcccgccagcattccaattccaacatggtcattatgcttattggaaataaa
agtgatttagaatctagaagagaagtaaaaaaagaagaaggtgaagcttttgcacgagaa
catggactcatcttcatggaaacgtctgctaagactgcttccaatgtagaagaggcattt
attaatacagcaaaagaaatttatgaaaaaattcaagaaggagtctttgacattaataat
gaggcaaatggcattaaaattggccctcagcatgctgctaccaatgcaacacatgcaggc
aatcagggaggacagcaggctgggggcggctgctgttga

DBGET integrated database retrieval system