KEGG   Homo sapiens (human): 5874Help
Entry
5874              CDS       T01001                                 

Gene name
RAB27B, C25KG
Definition
(RefSeq) RAB27B, member RAS oncogene family
  KO
K07886  Ras-related protein Rab-27B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5874 (RAB27B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5874 (RAB27B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5874 (RAB27B)
   04031 GTP-binding proteins [BR:hsa04031]
    5874 (RAB27B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    5874 (RAB27B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5874 (RAB27B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    5874 (RAB27B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU AAA_24 ATP_bind_1 AAA_22 Gtr1_RagA TPP_enzyme_M CENP-M
Motif
Other DBs
NCBI-GeneID: 5874
NCBI-ProteinID: NP_004154
OMIM: 603869
HGNC: 9767
Ensembl: ENSG00000041353
Vega: OTTHUMG00000132710
Pharos: O00194(Tbio)
UniProt: O00194
Structure
PDB: 

Position
18q21.2
AA seq 218 aa AA seqDB search
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNG
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL
IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatggagactatgattatctgatcaaactcctggccctcggggattcaggggtg
gggaagacaacatttctttatagatacacagataataaattcaatcccaaattcatcact
acagtaggaatagactttcgggaaaaacgtgtggtttataatgcacaaggaccgaatgga
tcttcagggaaagcatttaaagtgcatcttcagctttgggacactgcgggacaagagcgg
ttccggagtctcaccactgcatttttcagagacgccatgggcttcttattaatgtttgac
ctcaccagtcaacagagcttcttaaatgtcagaaactggatgagccaactgcaagcaaat
gcttattgtgaaaatccagatatagtattaattggcaacaaggcagacctaccagatcag
agggaagtcaatgaacggcaagctcgggaactggctgacaaatatggcataccatatttt
gaaacaagtgcagcaactggacagaatgtggagaaagctgtagaaacccttttggactta
atcatgaagcgaatggaacagtgtgtggagaagacacaaatccctgatactgtcaatggt
ggaaattctggaaacttggatggggaaaagccaccagagaagaaatgtatctgctag

DBGET integrated database retrieval system