KEGG   Homo sapiens (human): 83452Help
Entry
83452             CDS       T01001                                 

Gene name
RAB33B, SMC2
Definition
(RefSeq) RAB33B, member RAS oncogene family
  KO
K07920  Ras-related protein Rab-33B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    83452 (RAB33B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83452 (RAB33B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    83452 (RAB33B)
   04031 GTP-binding proteins [BR:hsa04031]
    83452 (RAB33B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab GTPases
    83452 (RAB33B)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    83452 (RAB33B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   83452 (RAB33B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab33
    83452 (RAB33B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU SRPRB G-alpha TniB ATP_bind_1 PduV-EutP AAA_24
Motif
Other DBs
NCBI-GeneID: 83452
NCBI-ProteinID: NP_112586
OMIM: 605950
HGNC: 16075
Ensembl: ENSG00000172007
Vega: OTTHUMG00000133384
Pharos: Q9H082(Tbio)
UniProt: Q9H082
Position
4q31.1
AA seq 229 aa AA seqDB search
MAEEMESSLEASFSSSGAVSGASGFLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPD
RTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMA
SFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAK
NPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagatggagtcgtcgctcgaggcaagcttttcgtccagcggggcagtgtca
ggggcctcagggtttttgcctcctgcccgctcccgcatcttcaagataatcgtgatcggc
gactccaatgtgggcaagacatgcctgacctaccgcttctgcgctggccgcttccccgac
cgcaccgaggccacgataggggtggatttccgagaacgagcggtggagattgatggggag
cgcatcaagatccagctatgggacacagcaggacaagaacgattcagaaagagcatggtt
cagcactactacagaaatgtacatgctgttgtcttcgtgtatgatatgaccaacatggct
agttttcatagcctaccatcttggatagaagaatgcaaacaacatttgctagccaatgat
ataccacggattcttgttggaaataaatgtgacttgagaagtgccatacaggtacccaca
gacttggcacaaaaatttgctgacacacacagtatgcctttgtttgaaacgtctgctaaa
aaccccaatgataatgaccatgtggaagctatatttatgaccttggctcataagcttaag
agccacaaaccattaatgcttagtcagccccctgataatggaattatcctgaagcctgaa
ccaaagcctgcaatgacgtgctggtgctaa

DBGET integrated database retrieval system