KEGG   Methanocaldococcus sp. FS406-22: MFS40622_0786
Entry
MFS40622_0786     CDS       T01175                                 
Name
(GenBank) AAA family ATPase, CDC48 subfamily
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
mfs  Methanocaldococcus sp. FS406-22
Brite
KEGG Orthology (KO) [BR:mfs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mfs03019]
    MFS40622_0786
   03009 Ribosome biogenesis [BR:mfs03009]
    MFS40622_0786
   04131 Membrane trafficking [BR:mfs04131]
    MFS40622_0786
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mfs04147]
    MFS40622_0786
Messenger RNA biogenesis [BR:mfs03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     MFS40622_0786
Ribosome biogenesis [BR:mfs03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    MFS40622_0786
Membrane trafficking [BR:mfs04131]
 SNARE
  SNARE associated proteins
   Others
    MFS40622_0786
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    MFS40622_0786
Exosome [BR:mfs04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MFS40622_0786
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_2 CDC48_2 AAA_5 AAA_16 TIP49 AAA_33 AAA_14 Vps4_C AAA_22 AAA_18 AAA_28 DUF815 Sigma54_activat IstB_IS21 Mg_chelatase AAA_7 RNA_helicase Zeta_toxin AAA_24 TsaE AAA_3 PhoH AAA_17 ABC_tran Sigma54_activ_2 bpMoxR AAA_30 DUF2075 AFG1_ATPase ATPase Baculo_PEP_C Viral_helicase1 Allexi_40kDa DUF2203 TMP_3 PhageMin_Tail DUF1572 Glutaredoxin2_C UFD1 Molydop_binding Baculo_p24 Sec34 DUF5798 Med15_fungi
Other DBs
NCBI-ProteinID: ADC69471
UniProt: D3S3Q7
Position
complement(783440..786151)
AA seq 903 aa
MVKELKVAEAYQGDVGRGIARIDPYTMEELGLKPGDVIEIEGTKGKAYAIVYRGFLEDAG
KGIIRIDGYLRQNAGVAIGDRVKVKKVEIKEAKKVVLAPTQPIRFGPGFEDFIKRKILGQ
VLSKGSKVTIGVLGTALTFVVVSTTPTGPVRVTDFTQVELKEEPVSEIKETKIPDVTYED
IGGLKEEVKKVREMIELPMRHPELFEKLGIEPPKGVLLVGPPGTGKTLLAKAVANEAGAN
FYVINGPEIMSKYVGETEENLRKIFEEAEENAPSIIFIDEIDAIAPKRDEATGEVERRLV
AQLLTLMDGLKGRGQVVVIGATNRPNALDPALRRPGRFDREIVIGVPDREGRKEILQIHT
RNMPLAEDVDLDYLADVTHGFVGADLAALCKEAAMRALRRVLPSIDLEAEEIPKEVLDNL
KVTMDDFKEALKDVEPSAMREVLVEVPNVKWEDIGGLEEVKQELREAVEWPLKAKEVFEK
IGVRPPKGVLLFGPPGTGKTLLAKAVANESGANFISVKGPEIFSKWVGESEKAIREIFRK
ARQSAPCIIFFDEIDAIAPKRGRDLSSAVTDKVVNQLLTELDGMEEPKDVIVIAATNRPD
IIDPALLRPGRLDRVILVPVPDEKARLDIFKIHTRAMNLAEDVSLEELAKKTEGYTGADI
EALCREAAMLAVRESIGKPWGIETALRDLINYLQSISGTFRGAAVELNSVIKATKERESA
EAGEFSELKNAIGKIISVLAPAKEKIEAVEKEVDKFLEIINKEDLKPSEKDEANKLAKYL
KDILGKLKEMIDNIYELENKLNTLKEQVSAEEIDEIIKTTQNIIQRFTTSLDELKNILKD
IESIRLKVSTKDVKIKKEHFMKALEKIRPSVSKEDMRVYEKLAQEYGRATSVEKKKEEGK
EVI
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggttaaggaattaaaagttgctgaagcatatcagggagatgttgggaggggtattgcg
agaatagacccctacacaatggaagaactcgggttaaaaccaggagatgttattgaaatt
gaaggaactaagggaaaagcttacgctatagtttatagaggtttcttagaagatgctgga
aaaggaattattagaattgatggttatttaaggcagaacgctggagtagccattggagat
agagtgaaggttaaaaaagtagagattaaagaggcaaagaaagtagtcttagccccaaca
cagccaattagattcggccctggatttgaagactttattaagagaaagatactggggcaa
gttttaagcaaaggttcaaaagtcactattggagttttagggactgccttaacatttgtg
gttgttagtacaactccaactggacctgttagagtaactgacttcacacaagttgaattg
aaagaagagccagtcagtgaaattaaagaaactaagattccagatgttacatatgaagat
attggtggtttgaaagaggaagttaagaaagttagagagatgatagagcttccaatgaga
catccagaattgtttgaaaagttaggaattgaaccaccaaaaggagttttattagttgga
ccaccaggaactggaaagactttattagctaaagcagtagctaacgaagctggagcaaac
ttctacgtaattaacggtccagagataatgagtaagtatgttggagagacagaggagaat
ttaagaaagatatttgaagaagctgaagagaacgctccaagtataatattcattgatgag
attgatgctatagcaccaaagagagatgaagctacaggagaagtagagagaagattagtt
gctcagctcttaaccttaatggatggattgaaaggaagaggacaagttgttgtcattggt
gcaacaaatagaccaaatgcattagacccagctttaagaagaccaggaagatttgataga
gagattgttattggagtgccagatagagaaggtagaaaagagatattgcaaatacacaca
agaaacatgccattagctgaagatgttgatttagactacttagcagatgtaacacacgga
tttgttggggctgatttagcagctttatgtaaagaggcagcaatgagggcattgagaaga
gtattgccaagcattgacttagaggcagaagagattccaaaagaagtgttagataactta
aaagtcacaatggacgacttcaaagaggcattgaaagatgttgagccatcagcaatgaga
gaggttttagttgaagttccaaatgttaagtgggaagatatcggaggattagaggaggtt
aagcaagaattaagagaggcagtagaatggcctttaaaagctaaggaagtatttgaaaaa
ataggagttagaccacctaagggagtattgctatttggaccaccaggaacaggtaagaca
ttattagctaaggctgtagctaacgaaagtggagcaaacttcataagcgttaaggggcca
gaaatctttagcaaatgggtaggggaaagtgagaaagcaataagagagatattcagaaag
gcaagacagtcagcaccatgtataatattcttcgatgagattgatgctatagcaccaaag
agaggtagagacttgagctcagcagttacagataaggttgtcaaccaattattaactgaa
ttggatggaatggaagagccaaaggacgttattgttattgccgcaacaaacagaccagat
atcattgacccagctttattgagaccaggaagattggacagggttatattagtcccagtt
ccagatgaaaaggcaagattggatatattcaagatacacacaagagctatgaacttagct
gaggatgttagcttagaagagcttgctaagaaaactgagggctacactggggctgatatt
gaggcattgtgtagagaagcagcaatgttagcagttagagagagtataggaaaaccatgg
ggaattgaaacagctttaagagacttaatcaactacttacagagcatttcaggaacattc
agaggagcggctgtagagttaaacagtgtcattaaagctacaaaagagagagaatctgct
gaagcaggagagttcagtgagttaaagaatgccattggaaagataattagcgttttagct
ccagctaaggagaaaattgaagcagtagaaaaagaagttgataaattccttgaaattata
aacaaagaagacttgaagccatcagagaaagatgaagctaataagttagcaaaatactta
aaggacatattaggcaagttaaaagaaatgatagacaacatctacgagttggagaacaag
ttgaataccttaaaagaacaagtttcagctgaagagattgatgagataattaaaacaaca
caaaatatcattcaaagattcacaacatcattggatgagctcaagaacatattaaaggat
attgagagcataagattgaaagtttcaacaaaagatgttaagattaaaaaagaacacttc
atgaaagctctcgagaagattagaccatccgtaagtaaggaggatatgagagtttatgaa
aagttggctcaagagtatggaagagccacatcagttgaaaagaaaaaagaagaaggtaaa
gaagtaatctaa

DBGET integrated database retrieval system