KEGG   Mesorhizobium japonicum MAFF 303099: mlr6397Help
Entry
mlr6397           CDS       T00043                                 

Definition
(GenBank) conjugal transfer protein; TraB
  KO
K20527  type IV secretion system protein TrbB
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mlo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    mlr6397
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mlo02044]
    mlr6397
Secretion system [BR:mlo02044]
 Type IV secretion system
  Trb secretion system protein
   mlr6397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE TrwB_AAD_bind Zeta_toxin DEAD AAA_16 FtsK_SpoIIIE ATPase AAA_28 GTP_EFTU IstB_IS21 MMR_HSR1 CPT Dynamin_N CbiA CLP1_P AAA_29 ABC_tran AAA_7 SRPRB KTI12
Motif
Other DBs
NCBI-ProteinID: BAB52702
RhizoBase: mlr6397
UniProt: Q989J4
Position
5220585..5221553
Genome map
AA seq 322 aa AA seqDB search
MSAHPEADHRRRAMLRTAMGPTITEALADPLVIEVMVNPDGALRLDRLGEGRIDTAVHMH
PSEAERIIRLVASHVRAEAHADNPIVSAELPSGERFEGLLPPVVLAPCFAIRKPAAKLYT
LANYVADRIMLPLQADALIKAVRERRNILVAGGTSSGKTTLANALLAEVAECDERVILIE
DTRELQCAAKDCVALRTRRGSVTLADLVRSTLRLRPDRIIVGEVRGAEALDMLKAWNTGH
PGGIATVHANSARSALYRIEQLAQEAVVTVPRRLIADAIDLIVFIAGRGSSRRIDAIAEV
TGLDGSGDYAVSPLTPPQLQQL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcatccagaggccgaccaccgacgccgcgccatgctgcgcaccgccatgggt
ccgacgatcactgaggcgctggccgatccattggtcatcgaggtgatggtcaatcccgat
ggtgcgctgcggctcgaccggctgggagaaggccgaatcgatacggccgtgcatatgcat
ccttccgaggcggaacgcatcatccgcctggtcgcttcccacgtgcgtgccgaggcgcat
gcggacaatccgattgtcagcgccgaattgccatcgggcgaacgcttcgagggactgctg
ccgcctgtcgtgctggcgccttgctttgccatccgcaaaccagccgcaaagctctacacg
ctggccaactatgttgcggatcgcatcatgttgccgctgcaggccgatgcgttgataaag
gcagtccgagaacggcgcaacatccttgtcgccggaggcacgtcgtcgggtaagacgacg
cttgccaatgcgctgctggccgaagtcgccgaatgcgacgagcgagtgatcctcatcgag
gacacccgcgaactgcaatgcgcagcaaaggactgcgttgccctgagaaccaggcggggc
tcggtcacactcgccgatctcgtgcgctcgacgctccggctccgtcccgaccgcatcatc
gtcggtgaagtcaggggcgcggaagcgctggacatgctcaaggcatggaacaccgggcac
cccggcggcatcgccacggttcatgccaattcggcgcgctctgccctctatcgcatcgag
cagcttgcacaggaagctgtcgtcaccgtgccgcgccgcctcatcgccgatgccatcgat
ctcatcgtcttcatcgcggggcgcggctcgtcgcgccgcatcgatgcaatcgctgaggtc
acaggtctcgacggcagcggcgactacgccgtctccccactcacgcctccgcaactccag
caactctga

DBGET integrated database retrieval system