KEGG   Mus musculus (house mouse): 100972
Entry
100972            CDS       T01002                                 
Symbol
Rab28, 2700023P08Rik, AW496496
Name
(RefSeq) RAB28, member RAS oncogene family
  KO
K07915  Ras-related protein Rab-28
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    100972 (Rab28)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab28
    100972 (Rab28)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA PduV-EutP G-alpha XFP_N DLIC
Other DBs
NCBI-GeneID: 100972
NCBI-ProteinID: NP_081571
MGI: 1917285
Ensembl: ENSMUSG00000029128
UniProt: Q99KL7 Q3TWY9
Position
5:complement(41782316..41865535)
AA seq 221 aa
MSDSEEESQDRQLKIVVLGDGTSGKTSLATCFAQETFGKQYKQTIGLDFFLRRITLPGNL
NVTLQVWDIGGQTIGGKMLDKYIYGAQGILLVYDITNYQSFENLEDWYSVVKTVSEESET
QPLVALVGNKIDLEHMRTVKADKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGI
KLNKAEIEQSQRVVKADIVNYNQEPLSRTVNPPRSSMCAVQ
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtcagactctgaggaggagagccaggaccggcaactgaaaatcgtcgtgctgggggac
ggcacctcggggaagacctccttagctacgtgttttgctcaagagacatttgggaagcag
tacaagcagacgataggactggatttctttttgagaaggattaccttaccaggaaatttg
aatgttactcttcaagtttgggatataggagggcagacaataggtggcaagatgttggat
aaatacatctatggagcacagggaatcctcttggtatatgatattacaaactaccaaagc
tttgagaatttggaagattggtattctgtggtgaagacagtaagtgaagagtcagaaact
cagcccctggttgctttagtgggcaataaaattgacttggagcatatgcgaacagtaaaa
gctgataagcacttacgattttgccaggaaaatggttttagtagccactttgtttcagcc
aagacaggagactctgtcttcctgtgttttcagaaagttgcagcagaaatcctgggaatc
aaattaaacaaagcagaaatagaacagtcacagagagtggtgaaggcagatattgtaaac
tacaaccaggagcccttgtcaagaactgttaaccctcctcggagctccatgtgtgcagtg
cagtga

DBGET integrated database retrieval system