KEGG   Mus musculus (mouse): 110147Help
Entry
110147            CDS       T01002                                 

Gene name
Ehmt2, Bat8, D17Ertd710e, G9a, KMT1C, NG36
Definition
(RefSeq) euchromatic histone lysine N-methyltransferase 2
  KO
K11420  [histone H3]-lysine9 N-trimethyltransferase EHMT [EC:2.1.1.355]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
mmu04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110147 (Ehmt2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    110147 (Ehmt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    110147 (Ehmt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     110147 (Ehmt2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110147 (Ehmt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 SET Pre-SET CDC45 Nop14 Paf1 Sporozoite_P67 RNA_pol_3_Rpc31 XRCC4 Nop53
Motif
Other DBs
NCBI-GeneID: 110147
NCBI-ProteinID: NP_665829
MGI: 2148922
Ensembl: ENSMUSG00000013787
Vega: OTTMUSG00000016295
UniProt: Q9Z148
Position
17 B1; 17 18.45 cM
AA seq 1263 aa AA seqDB search
MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGL
TGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERVHSSLGDTPQSEETLPKANPDSLEPAG
PSSPASVTVTVGDEGADTPVGAASLIGDEPESLEGDGGRIVLGHATKSFPSSPSKGGACP
SRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAATAGPEPSPATTAAQEGQPKVHRARKT
MSKPSNGQPPIPEKRPPEVQHFRMSDDMHLGKVTSDVAKRRKLNSGSLSEDLGSAGGSGD
IILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSKSEVEALAEQLSEEEEEEEEE
EEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRA
KEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCS
CRMEAPKIDRISERAGHKCMATESVDGELLGCNAAILKRETMRPSSRVALMVLCEAHRAR
MVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVT
IPRGDGGTPPIGTAAPALPPLAHDAPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSG
PSLTLPNGGCLSAVGLPPGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVI
LMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVV
NNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWT
PIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAV
NYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKL
RLGVGNRAVRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRN
ITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRSC
KNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLF
DLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTG
EELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPP
INT
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtctgccgagagggagggggctgatgcgggcccgggggcgggggcgtgcggcc
cccacgggcggccgcggccgcggtcgggggggcgcccaccgagggcgaggtaggccccga
agcctgctctcgctgcccagggcccaggcgtcttgggccccccagctgcctgccgggctg
accggccccccggttccttgtctcccctcccagggggaggcccccgctgagatgggggcg
ctgctgctggagaaggagccccgaggagccgccgagagagttcatagctctttgggggac
acccctcagagtgaggagacccttcccaaggccaaccccgactccttggagcctgccggc
ccctcctctccggcctctgtcactgtcaccgtcggcgatgagggggctgacacccctgtc
ggggccgcatcactcatcggggacgaacccgagagcctggagggagatgggggtcgcatc
gtgctgggccatgccacaaagtcgttcccctcttcccccagcaaggggggtgcctgtccc
agtcgggccaaaatgtcaatgacaggggcaggaaagtcgcccccctcggtccagagtttg
gccatgaggctgttgagcatgcccggggcccagggagctgcaactgctgggcctgaaccc
tctccggcaacaactgccgcccaggaggggcagcccaaagtgcaccgagcccggaaaacc
atgtccaaacctagcaacggacagcctccaatccctgagaagcggccccctgaagtccag
catttccgcatgagtgatgacatgcatctggggaaggtgacttcagatgtggccaaaagg
aggaagctgaactctggtagcctgtccgaggacttgggctctgccgggggctcaggagat
ataatcctggagaagggagagcccaggcccctggaggagtgggagacggtggtgggcgat
gacttcagcctgtactatgatgcgtactctgtggatgagcgggtggactctgacagcaag
tctgaagtcgaagctctagctgaacagttgagtgaggaggaggaggaggaagaggaggaa
gaagaagaagaggaggaggaggaggaagaggaggaggaggaagaagaggacgaggagtcg
ggcaatcagtcagacaggagcggttctagtggccggcgcaaggccaagaagaaatggcgg
aaagacagcccgtgggtgaagccatctagaaaacggcggaaacgagagcctccgagggcc
aaggagccaagaggagtgaatggtgtgggttcctcagggcccagtgagtacatggaggtt
cctctggggtccctggagctgcccagcgaggggaccctctcccccaaccacgctggggtc
tccaatgacacgtcttcactggagacagaacgcgggtttgaggagctgcccctctgcagc
tgccgcatggaggctcccaagattgaccgcatcagcgagagagcagggcacaagtgcatg
gccacagagagtgtggatggagagctcctgggctgcaatgctgccatccttaagcgggag
accatgcggccgtctagccgcgtggcgctgatggtgctctgtgaggcccatcgagcccgc
atggtcaagcaccattgctgcccgggctgcggctacttctgcacagcgggcaccttcctg
gaatgccaccccgactttcgtgtagctcaccgcttccataaggcctgcgtatcccagctc
aatgggatggtcttctgtccccactgtggagaggatgcctcagaggcccaggaggtgacc
attcctcggggcgatgggggaacacccccaattggcaccgcagctcctgctctgccaccc
ctggcacatgatgccccagggcgagcggatacctcccagcctagcgcccgaatgcgaggg
catggagagccgcggcgcccgccctgtgatcccctggctgacaccatcgacagctcaggg
ccttcactgactctgcctaatgggggctgcctctccgctgtgggtctgcccccagggccg
ggcagggaagccctggaaaaagccttggtcatccaggagtctgagaggcggaagaagctg
cgattccacccacggcagctgtacctgtcggtgaagcagggggagctgcagaaggtgatc
cttatgctgttagacaacctggaccccaacttccagagcgaccagcagagcaagcgcacg
cccctgcacgcggccgcccagaaggggtcggtagagatctgtcatgtgctgctgcaggca
ggagccaacatcaatgccgtagataagcaacaacgcacgccactaatggaggccgtggtg
aacaaccacctggaggtggcacgctacatggtgcagttaggtggctgtgtctacagcaag
gaagaggatggctccacctgtctacatcatgcagccaaaattgggaacttggaaatggtc
agcctgctactgagcacaggacaggtggacgtcaatgcccaggacagtgggggctggacg
cccatcatctgggcagccgagcacaagcacatcgatgtgattcgtatgctgctgacccgg
ggtgccgatgtcaccctgactgacaatgaggaaaacatctgcctgcactgggcctccttc
acgggtagtgccgccatcgctgaggtccttctgaatgcccagtgtgatctccatgctgtc
aactaccatggggacacgcccctgcacatagccgccagggagagctaccatgactgtgtt
ctgttgttcctgtctcgtggagccaaccctgagcttcggaacaaagaaggagacacggca
tgggatctgaccccagagcgctctgatgtgtggtttgcactgcagctcaatcgaaagctt
aggcttggggtagggaaccgggctgtccgcaccgagaagatcatctgccgggacgtagcc
cgaggctatgagaatgtacccatcccctgtgtcaatggtgtggatggggagccgtgcccg
gaggactacaagtacatctctgagaactgcgagacatcgaccatgaacatcgaccgcaac
atcacccatctgcagcactgcacgtgtgtggatgactgctccagctccaattgcctatgt
ggtcagctcagtatccgatgctggtatgacaaggacgggcggctgctccaggagtttaac
aagatcgagccccccctgatctttgagtgtaaccaggcatgctcctgctggagaagctgc
aagaaccgcgtggtgcagagcggcatcaaggtacggctgcagctctaccggactgccaag
atgggctggggggtccgagccttgcagaccatcccccagggcacgttcatctgcgagtat
gtaggagagctgatctctgatgccgaggctgatgtgagagaggatgattcttacctcttc
gatttagataacaaggatggcgaggtttactgcattgatgcccgttactatggcaacatc
agccgattcattaaccacctgtgtgaccccaacatcatccctgtccgggttttcatgctg
caccaagatctacggttcccacgcattgccttcttcagctccagggacatccggactggg
gaggagctgggctttgactacggtgaccgattctgggacatcaagagcaagtatttcacc
tgccagtgtggctctgagaagtgcaagcattcagcggaggccatcgccctggagcagagc
cgcctggcccggctggacccccacccggagctgctccctgacctcagctccctgcccccc
atcaacacctga

DBGET integrated database retrieval system