KEGG   Mus musculus (house mouse): 11840
Entry
11840             CDS       T01002                                 
Symbol
Arf1
Name
(RefSeq) ADP-ribosylation factor 1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu05132  Salmonella infection
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    11840 (Arf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    11840 (Arf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    11840 (Arf1)
   05134 Legionellosis
    11840 (Arf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11840 (Arf1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11840 (Arf1)
   04031 GTP-binding proteins [BR:mmu04031]
    11840 (Arf1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    11840 (Arf1)
  Arf GTPases and associated proteins
   Arf GTPases
    11840 (Arf1)
 Endosome - Golgi transport
    11840 (Arf1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   11840 (Arf1)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    11840 (Arf1)
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K
Other DBs
NCBI-GeneID: 11840
NCBI-ProteinID: NP_001123880
MGI: 99431
Ensembl: ENSMUSG00000048076
UniProt: P84078
Structure
Position
11:complement(59102238..59119093)
AA seq 181 aa
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
K
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggaatatctttgcaaacctcttcaagggcctttttggcaaaaaagaaatgcgcatt
ctcatggtgggcctggatgctgcagggaagacaacaattctatacaaacttaagctgggc
gaaattgtgaccaccattcccaccattggtttcaatgtggagactgttgaatacaagaat
atcagcttcaccgtgtgggatgtgggcggccaggacaagatccggccgctgtggcgccac
tacttccagaacacccaaggcttgatcttcgtagtggacagcaatgacagagagcgtgtg
aacgaggcccgtgaagagctcatgaggatgctagctgaagatgagctccgagatgctgtt
ctcttggtgtttgccaacaagcaggacctccccaatgccatgaatgcggccgaaatcaca
gacaagctggggctgcactctctacgccacaggaactggtacattcaggccacctgtgcc
accagcggggacgggctctatgaaggactagattggctgtctaatcagctccggaaccag
aagtga

DBGET integrated database retrieval system