KEGG   Mus musculus (mouse): 19328Help
Entry
19328             CDS       T01002                                 

Gene name
Rab12, 2900054P15Rik, AW555448, C77700
Definition
(RefSeq) RAB12, member RAS oncogene family
  KO
K07907  Ras-related protein Rab-12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19328 (Rab12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19328 (Rab12)
   04031 GTP-binding proteins [BR:mmu04031]
    19328 (Rab12)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    19328 (Rab12)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    19328 (Rab12)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19328 (Rab12)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab12/18
    19328 (Rab12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA SRPRB RsgA_GTPase AAA_16 Septin AAA_14 AAA_24 AAA PduV-EutP NACHT AAA_22 FeoB_N AAA_23
Motif
Other DBs
NCBI-GeneID: 19328
NCBI-ProteinID: NP_077768
MGI: 894284
Ensembl: ENSMUSG00000023460
Vega: OTTMUSG00000021023
UniProt: P35283
Position
17; 17 E1.1
AA seq 243 aa AA seqDB search
MDPSAALHRRPAGGSLGAVSPALSGGQARRRKQPPRPADFKLQVIIIGSRGVGKTSLMER
FTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILV
YDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMR
FCEASAKDNFNVDEIFLKLVDDILKKMPLDVLRNELSNSILSLQPEPEIPPELPPPRPHV
RCC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggatcccagcgccgcgctgcaccggcggcccgcgggcggcagcctgggcgcggtctcc
ccggcgctgtcgggcggccaggcccgccggaggaagcagccccccaggccggccgacttc
aagctgcaggtcatcatcatcggctcccgcggcgtgggcaagaccagcctgatggagcgc
ttcaccgacgacacgttctgcgaggcctgcaagtccaccgtgggtgttgactttaaaatc
aagactgtagaactaagagggaagaaaattagattacagatctgggacacagcagggcag
gagcgatttaacagcattacctcagcctattacagaagtgccaaggggatcatactcgta
tatgacatcaccaagaaggagacgttcgatgacttgccaaagtggatgaagatgattgac
aagtatgcttcagaagacgccgagctcctcctggttggaaataagctggactgtgagaca
gacagagaaatctcaaggcagcaaggagaaaagtttgcacagcagataaccgggatgcgc
ttctgcgaagccagtgccaaggacaatttcaatgtggacgagatctttctgaaacttgtt
gatgatattctgaaaaagatgcctcttgatgttttgagaaacgagttatccaatagcatc
ctttctctacaaccagagcctgagatcccaccagagctgcctcctcccagaccacacgtc
cgatgctgttga

DBGET integrated database retrieval system