KEGG   Mus musculus (mouse): 19331
Entry
19331             CDS       T01002                                 

Symbol
Rab19
Name
(RefSeq) RAB19, member RAS oncogene family
  KO
K17047  Ras-related protein Rab-19
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19331 (Rab19)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab19/30/43 [OT]
    19331 (Rab19)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU TniB SRPRB FeoB_N PduV-EutP Septin
Other DBs
NCBI-GeneID: 19331
NCBI-ProteinID: NP_035356
MGI: 103292
Ensembl: ENSMUSG00000029923
Vega: OTTMUSG00000022161
UniProt: P35294
Position
6; 6 B1
AA seq 217 aa
MQFSSSSRTSDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLE
IDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGA
ANLVIMLIGNKSDLWEKRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELI
ARNSLHLYGESAQQGLSQDSSPVLVAQVPNESTRCTC
NT seq 654 nt   +upstreamnt  +downstreamnt
atgcagttctccagctcatccaggacatcagatgagaatgtggactatttgttcaaggtc
atccttattggggactccaacgtggggaagacatgtgtggttcagcatttcaaatctgga
gtctacagtgagtcccagcagaacaccattggggtggacttcaccgtgcgctccctcgag
atagacggcaagaaagtgaagatgcaggtgtgggacacggcaggccaggagcgcttccgt
accatcacccaaagctactaccggagtgcccacgcagctatcatcgcttatgatctcaca
cggcggtccacattcgaatctgtccctcactggatccacgagatagaaaaatatggagct
gccaacttggtcatcatgctgatcgggaacaaatcagacctgtgggagaagcggcatgtc
ctgtttgaggatgcctgcacactggctgagaagcatggcctcctggctgtcttggagaca
tccgccaaggagtccaggaacatagatgaagtctttgtgctcatggcgaaggagttaatt
gcccgcaacagcctgcacctgtatggggagagtgcccagcaaggtctttcccaggattcc
agcccagttcttgtggcccaggtccccaatgagagcacccgctgtacttgttga

DBGET integrated database retrieval system