KEGG   Mus musculus (mouse): 19339Help
Entry
19339             CDS       T01002                                 

Gene name
Rab3a
Definition
(RefSeq) RAB3A, member RAS oncogene family
  KO
K07882  Ras-related protein Rab-3A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    19339 (Rab3a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    19339 (Rab3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19339 (Rab3a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19339 (Rab3a)
   04031 GTP-binding proteins [BR:mmu04031]
    19339 (Rab3a)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    19339 (Rab3a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   19339 (Rab3a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    19339 (Rab3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA GTP_EFTU AAA_24 DUF2757 AAA_16 Septin
Motif
Other DBs
NCBI-GeneID: 19339
NCBI-ProteinID: NP_001159871
MGI: 97843
Ensembl: ENSMUSG00000031840
Vega: OTTMUSG00000016949
UniProt: P63011 Q0PD63
Position
8 B3.3; 8 34.15 cM
AA seq 220 aa AA seqDB search
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgccacagactctcgctatgggcagaaggagtcctcagaccagaacttcgac
tatatgttcaagatcctgatcattgggaacagcagcgtgggcaaaacctcgttcctcttc
cgctacgcagatgactccttcactccagcctttgtcagcaccgttggcatagacttcaag
gtcaaaaccatctaccgcaacgacaagaggatcaagctgcagatctgggacacagcaggg
caagagcggtaccgcaccatcaccacagcctattaccgaggcgccatgggcttcatccta
atgtatgacatcaccaatgaggagtcatttaatgcagtgcaggactggtccactcagatc
aaaacttactcgtgggacaatgcccaggtgctgctggtgggaaacaagtgtgacatggaa
gatgagcgagtggtgtcctcagagcgtggccggcagctggctgaccacctgggctttgag
ttctttgaggccagcgccaaggacaacattaatgtcaagcagacgtttgaacgtctggtg
gacgtgatctgtgagaagatgtcagagtccctggatactgcagaccctgcggtcaccggt
gccaagcagggcccgcagctcaccgaccagcaggcgccacctcatcaggattgtgcctgc
tga

DBGET integrated database retrieval system