KEGG   Mus musculus (house mouse): 19340
Entry
19340             CDS       T01002                                 
Symbol
Rab3d, C130057E11Rik
Name
(RefSeq) RAB3D, member RAS oncogene family
  KO
K07884  Ras-related protein Rab-3D
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    19340 (Rab3d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19340 (Rab3d)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19340 (Rab3d)
   04031 GTP-binding proteins [BR:mmu04031]
    19340 (Rab3d)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    19340 (Rab3d)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   19340 (Rab3d)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    19340 (Rab3d)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 Gtr1_RagA GTP_EFTU AAA_16 CPT
Other DBs
NCBI-GeneID: 19340
NCBI-ProteinID: NP_001311460
MGI: 97844
Ensembl: ENSMUSG00000019066
UniProt: P35276 Q543Q4
Position
9:complement(21818787..21829623)
AA seq 219 aa
MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDWATQI
KTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV
DIICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCSC
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcatccgctagtgagccccctgccagcccaagagacgctgctgaccagaactttgac
tacatgttcaaactgctcttgatcgggaacagcagcgtgggcaagacatccttcctgttc
cgctatgccgatgactccttcacccctgccttcgtgagcacagtgggcatcgacttcaag
gtcaagacggtctaccgacatgacaagaggatcaagctgcagatttgggacacagcaggc
caggagcgctaccggacaatcaccacggcctactatcgcggagctatgggtttcctgctc
atgtatgacatcgccaaccaggagtccttcaccgcggtgcaggactgggctacgcagatc
aaaacctattcctgggacaatgcccaggtaatcctcgtggggaacaagtgtgacctggaa
gacgaacgggtcgtacctgctgaggatggccggaggctcgccgatgatcttggttttgag
ttctttgaggccagcgccaaggagaatatcaatgtgaagcaggtgttcgagcgcctggtg
gacatcatctgtgacaagatgaatgaatccctggaacccagctccagcccaggcagcaat
ggaaaaggcccagcccttggggataccccacccccacagccgagcagctgcagctgttag

DBGET integrated database retrieval system