KEGG   Mus musculus (mouse): 19346
Entry
19346             CDS       T01002                                 

Symbol
Rab6a, 2610028L11Rik, AA419671, Ra, Rab6
Name
(RefSeq) RAB6A, member RAS oncogene family
  KO
K07893  Ras-related protein Rab-6A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19346 (Rab6a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19346 (Rab6a)
   04031 GTP-binding proteins [BR:mmu04031]
    19346 (Rab6a)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    19346 (Rab6a)
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
    19346 (Rab6a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   19346 (Rab6a)
  Exosomal proteins of bladder cancer cells
   19346 (Rab6a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    19346 (Rab6a)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA CPT TetR_C_16
Other DBs
NCBI-GeneID: 19346
NCBI-ProteinID: NP_001157135
MGI: 894313
Ensembl: ENSMUSG00000030704
Vega: OTTMUSG00000016494
UniProt: P35279 Q3U4W5
Position
7; 7 E2
AA seq 208 aa
MSAGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVI
IMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMEST
QDRSREDMIDIKLEKPQEQPVNEGGCSC
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctggga
gagcagagcgttggaaagacgtccttgatcacccgattcatgtatgacagttttgacaac
acctatcaggcaacaattggcattgacttcttatcaaaaacaatgtacttggaggataga
accatcaggctgcagctgtgggatactgcgggtcaggaacgtttccgtagcctcattccc
agttacatccgtgactctgctgcagccgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaaatggattgatgatgtcagaacagagagaggaagtgatgtcatc
atcatgctagtaggaaataaaacagatcttgctgataagaggcaagtgtcaattgaggag
ggagagaggaaagccaaagagctgaatgttatgtttattgaaaccagtgcaaaagcagga
tacaatgtaaagcagcttttccggcgtgttgctgcagctttacctggaatggaaagcaca
caggacagaagcagagaagacatgattgacataaaactggaaaagcctcaggagcaacca
gtcaatgaaggcggctgttcctgctaa

DBGET integrated database retrieval system