KEGG   Mus musculus (house mouse): 19376
Entry
19376             CDS       T01002                                 
Symbol
Rab34, AI326479, Narr, Rah, Rah1
Name
(RefSeq) RAB34, member RAS oncogene family
  KO
K07921  Ras-related protein Rab-34
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19376 (Rab34)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab34/36
    19376 (Rab34)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 SRPRB Gtr1_RagA AAA_14 TniB
Other DBs
NCBI-GeneID: 19376
NCBI-ProteinID: NP_001152954
MGI: 104606
Ensembl: ENSMUSG00000002059
UniProt: Q64008 Q0PD20
Position
11:78079253..78083019
AA seq 259 aa
MNILAPVRRDRVLAELPQCLKKEAALHVRKDFHPRVTCACQEHRTGTVGFKISKVIVVGD
LSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIAST
YYRGAQAIIIVFNLNDVASLEHTKQWLTDALKENDPSNVLLFLVGSKKDLSTPAQYSLME
KDALKVAQEIKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARHIADVVRIN
SDDKNLYLTASKKKATCCP
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaacattctggcgcccgtgcggagggaccgcgtcctggcggagctgccccagtgcctg
aagaaagaggccgctttgcacgtgcgcaaagacttccacccccgcgtcacttgcgcctgc
caggagcaccggacaggcaccgtgggatttaagatatccaaggtcatcgttgtgggagac
ctatctgtggggaagacctgtctcattaataggttctgcaaagacaccttcgataagaat
tacaaggctaccatcggagtggattttgagatggaacgatttgaagtcttgggtgtcccc
ttcagtctccaactttgggacacggctggtcaggaaaggttcaagtgcattgcttccacc
tactaccgtggagctcaagccatcatcattgtcttcaacctgaatgacgtggcatccctg
gaacacaccaagcagtggctcactgatgccctcaaggagaacgacccttccaacgtgctc
ctcttccttgtgggttccaagaaggacctgagtactcctgctcagtattccctaatggag
aaggatgccctcaaggtggcccaagagattaaggccgagtactgggcggtgtcctccctc
actggtgagaatgtccgggaattcttcttccgtgtggcagcactaacctttgaggccaat
gtcctggcggagctggagaaatccggggctcggcacattgcagatgttgttcgcatcaac
agcgatgacaaaaacctgtacctaactgccagcaagaaaaaggccacatgttgtccctga

DBGET integrated database retrieval system