KEGG   Mus musculus (house mouse): 226421
Entry
226421            CDS       T01002                                 
Symbol
Rab7b, 5430435G22Rik
Name
(RefSeq) RAB7B, member RAS oncogene family
  KO
K07898  Ras-related protein Rab-7B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04145  Phagosome
mmu05132  Salmonella infection
mmu05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    226421 (Rab7b)
   04140 Autophagy - animal
    226421 (Rab7b)
   04137 Mitophagy - animal
    226421 (Rab7b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    226421 (Rab7b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    226421 (Rab7b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    226421 (Rab7b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    226421 (Rab7b)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    226421 (Rab7b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    226421 (Rab7b)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 ATP_bind_1 cobW AAA_22 VirE AAA_14 Septin
Other DBs
NCBI-GeneID: 226421
NCBI-ProteinID: NP_663484
MGI: 2442295
Ensembl: ENSMUSG00000052688
UniProt: Q8VEA8
Position
1:131616412..131646288
AA seq 199 aa
MNPRKKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIIPMEQSYPMV
VLGNKIDLEDRKVSQEVVHGWCKEKDMPYFEVSAKNDINVVQAFEVLASRALLRYQGTAE
NHLIDSIKLSPGQPKSRCC
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaatccccgaaagaaagtggacttgaaacttatcattgttggtgcacttggcgtggga
aagacctctcttcttcaccaatatgtacacaaaacatttttcgaggaataccagaccaca
ctgggggccagcatcctctccaaaatcatcatattggatgacacaactttgaagctgcag
atctgggacacaggtggtcaggagcggttccgctcaatggtatcaacattctacaaaggt
tccgatggctgtatcctggcatttgatgttactgatccagagtcctttgaagccctggat
atctggagggatgatgtcctggcaaagattatccctatggagcagtcatatcccatggtg
gtgctggggaacaaaatcgatctggaagataggaaggtgtcccaggaggtggtccatggg
tggtgtaaagagaaggatatgccatattttgaagttagtgcgaagaatgacatcaatgtg
gtacaagcctttgaggttctggccagccgggctctgttgaggtaccagggcaccgcagag
aaccacctcatagactccatcaagctctctccaggccagccaaagagcagatgctgctga

DBGET integrated database retrieval system