KEGG   Mus musculus (mouse): 234663
Entry
234663            CDS       T01002                                 

Symbol
Dync1li2, AA409702, C920003I06, Dncli2, Dnclic2, LIC2
Name
(RefSeq) dynein, cytoplasmic 1 light intermediate chain 2
  KO
K10416  dynein cytoplasmic 1 light intermediate chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    234663 (Dync1li2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    234663 (Dync1li2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    234663 (Dync1li2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    234663 (Dync1li2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    234663 (Dync1li2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    234663 (Dync1li2)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    234663 (Dync1li2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      234663 (Dync1li2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     234663 (Dync1li2)
SSDB
Motif
Pfam: DLIC ABC_tran Arf AAA_16 AAA_22 PduV-EutP Roc AAA_7 AAA_29 AAA_24 NACHT AAA_25 ATPase G-alpha SRP54
Other DBs
NCBI-GeneID: 234663
NCBI-ProteinID: NP_001013398
MGI: 107738
Ensembl: ENSMUSG00000035770
Vega: OTTMUSG00000061912
UniProt: Q6PDL0
Position
8 D3; 8 53.04 cM
AA seq 492 aa
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLK
FAVSAESLRETLVIFVADMSRPWTIMESLQKWASVLREHIDKMKIPPEEMRDLERKFMKE
FQDYIEPEEGCQGSPQRRGPLTSGSDEDSVALPLGDNVLTHNLGIPVLVVCTKCDAMSVL
EKEHDYRDEHLDFIQAHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTIPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQ
VFLMKQQSLLAKQPATPTRTSESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPDPNIK
NNAASEGVLASFFNSLLSKKTGSPGSPSAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPD
SMVTNSSTENEA
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaagctgctgctgggtcccaacgggcccgcagtggcg
gccgccggcgacctgacaagtgaagaggaggaaggccagagtctatggtcttcgatcttg
agcgaagtgtccacccgtgccaggtccaagctgccgtccggcaaaaacattctggtgttc
ggtgaagatggttctggtaagacaactctcatgaccaaactccaaggagcagaacacggc
aaaaaaggaagaggcttagagtatctttacctcagcgttcatgatgaggaccgggacgat
cacacacgctgcaatgtgtggattttagatggagacctctaccataaaggcctgctgaaa
tttgcagtttcagctgagtctctgcgggagaccctggtcatttttgttgccgacatgtct
cgaccttggacgataatggagtctctgcagaagtgggctagtgttttacgggagcacatt
gacaagatgaagattccaccggaggagatgcgggatctggaacggaaatttatgaaagag
tttcaagattatatcgagcctgaagaaggttgtcagggttccccacagagaagagggcct
ctgacctcaggctcagacgaagacagtgttgccctccctctgggtgacaacgtgctgact
cataacctggggatcccagtgttggtggtgtgcacaaagtgtgatgccatgagcgtcttg
gagaaggagcacgattacagggacgagcacctggacttcatccaggcgcacctgcggaga
ttctgcctccagtatggagcagccttgatttacacctcagtgaaggaagagaaaaacctt
gacttgctgtataagtacattgttcataaaacctatggcttccactttaccatacccgcc
ttagttgtggaaaaggacgcggtttttatacctgcaggctgggacaatgaaaagaaaata
gctattttacatgaaaattttacaaccgtgaagccagaagacgcgtatgaagattttatt
gtaaagccgcctgtgagaaagctggtccatgacaaagagttggcagcggaggatgagcag
gtgttcctaatgaagcaacagtcactccttgccaagcagcctgccacgcccacaagaacc
tccgaatcccctgccagaggaccctctggctctccaaggacgcagggtcggggtggacca
gctagtgtaccaagtgcctcccccggaacttcagtaaagaagccagatccaaacatcaaa
aataatgcggcaagtgaaggggtattggccagcttcttcaatagtctgttgagtaaaaaa
acaggctctcccggaagtcctagtgctggtggagtgcagagcacagccaagaagtcagga
caaaagactgtgttgtcaaatgttcaggaagaactggatagaatgactcgaaagccagac
tccatggtaacaaactcttcaacagaaaatgaagcctga

DBGET integrated database retrieval system