KEGG   Mus musculus (house mouse): 242681
Entry
242681            CDS       T01002                                 
Symbol
Rab42, 9530096D07Rik, Rab42-ps
Name
(RefSeq) RAB42, member RAS oncogene family
  KO
K07929  Ras-related protein Rab-42
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    242681 (Rab42)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    242681 (Rab42)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 AAA_16 AAA_22 ABC_tran Baculo_F NACHT AAA_19 AAA_24
Other DBs
NCBI-GeneID: 242681
NCBI-ProteinID: NP_001075120
MGI: 2441753
Ensembl: ENSMUSG00000089687
UniProt: Q0PD08
Position
4:complement(132027749..132030693)
AA seq 215 aa
MEAAGCSYQFRIALLGDAGVGKTSLLRCYVAGARGAAEPDPEPTVGVEFYSRALQLPAGL
RVKLQLWDTAGQECFRCITRSFYRNMVGVLLVFDVTNRESFEHIQAWHQEVVSTQGPDKV
VFLLVGHKCDLNTRCVSSQEAEELAASLGMGFMETSAKSNCNVDLAFDTVTSAIEQALQQ
GDIKLDKDWAGVRLLHRSPNPRSSSRKQDSGTCQC
NT seq 648 nt   +upstreamnt  +downstreamnt
atggaggcggccggctgcagctaccaatttcggatcgcgctgctcggggacgcaggggtg
ggcaagacgtcactgctacggtgttacgtggcgggcgcgcggggggcggcggagccggat
cccgaacccactgtaggcgtggagttctacagccgcgcgctgcaactacccgctgggctg
cgagtcaaactgcagctctgggacaccgcaggccaagagtgcttcaggtgcatcaccagg
tctttttaccggaacatggtgggcgttctgttggtctttgatgtgacgaacagagagtcc
tttgaacacatccaagcctggcaccaggaggtcgtatccactcagggccctgacaaggtg
gtcttcttactggttggccacaagtgtgacctgaacacccgatgcgtatcctctcaggaa
gcagaggaacttgctgcctctctgggcatgggcttcatggagacctcggccaaaagcaac
tgcaatgtcgacctggcctttgacactgtcaccagcgccatcgaacaggccctgcagcag
ggggacatcaagctggacaaggactgggcgggtgtccggctcctccatagatctccaaac
cctagatcctctagcaggaagcaggactcaggcacatgccaatgttga

DBGET integrated database retrieval system