KEGG   Mus musculus (house mouse): 380698
Entry
380698            CDS       T01002                                 
Symbol
Obscn, Gm878, UNC89
Name
(RefSeq) obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
  KO
K17531  obscurin-RhoGEF [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    380698 (Obscn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    380698 (Obscn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     380698 (Obscn)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  Trio family [OT]
   380698 (Obscn)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    380698 (Obscn)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Pkinase Ig_4 Ig_5 PK_Tyr_Ser-Thr C1-set BiPBP_C Izumo-Ig C2-set_2 fn3 RhoGEF PH ABC1 IQ Pkinase_fungal IQ_SEC7_PH
Other DBs
NCBI-GeneID: 380698
NCBI-ProteinID: NP_001164983
MGI: 2681862
Ensembl: ENSMUSG00000061462
UniProt: H7BX05
Position
11:complement(58885082..59027201)
AA seq 8032 aa
MDHSFSGAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPHVSWEKDRQPVEAGARFRLAQD
GDVYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLRVDSEGTCAEQAPHFLLRPTSIRV
REGADATFRCRVGGSPQPAVSWSKDGRRLGPPDAPHVRVEEHGESSALRIRSARPRDGGT
YEVRAENPLGSASAAAALVVDSDAEVAGPPGTSTATLLAHLQQRREAMRAEGIPPSPPGA
GTRTCTVTEGKHARLSCFVTGEPKPETVWKKDGQLVTEGRRHVVYEDEQENFVLKILFCK
QSDRGLYTCTASNLVGQTYSSVLVVVREPTVPFKKRLQDLEVREKESATFQCEVAQPATE
AAWFKEETRLWASAKYDIEEEGTERRLTVRNVSADDDAVYICETTEGSRTVAELSVQGNL
TRKLPRKTAVRTGDTAIFWVELAVPEGPVRWLRNQEEMVAGGRVAITAEGTCHTLTIFQC
TLEDMGEVAFVSGGCRTTTQFCVSAPRRPPLYPPADPVVKAKTESSVTLSWSAPPHGDRP
VTIDGYVLEKRKLGAYAWSRCHEAGWLATTEFTITGVAEEGDFQFRVSAINHFGQGPYLE
FPGTMHLVPMLAVKTPLKAVEAVEGGEVTFSVDLTVASSGEWFLDGEALKASSIYVIRCD
RTRHMLTIREVPARLHGAQLKFVANGIETSIQMVVRAALGLPSSKLPAAAAREVLAQLHE
EAQLLAELSDQAAAVTWLKDGRELSLGPKYEMQVSAGRRALLVRDVAQDDAGLYECVSRG
SRTAYQLLVQDITDGYRDWGPAGPQKHMCKCAGAKIARYLGSSCYRFLQYDKGVWHWLEA
ALDTRQGKGTSSCSLHEKPKLVFAKGQQAHSEVKAEAGASATLSCEVAQAQTEVTWFKDG
KKLSSSSKVRMEASGCSRRLVVQQAGKADAGEYSCEAGGQKLSFRLDVAEPKMVFAKEQQ
ARSEVKAEAGASATLSCEVAQAQTEVTWFKDGKKLSSSSKVRMEASGCSRRLVVQQAGKA
DAGEYSCEAGGQKLSFRLDVTEPKLVFAKEQQARSEVKAEVGNSATLSCEVAQAQTEVTW
FKDGKKLSSSSKVRMEASGCSRRLVVQQAGKADAGEYSCEAGGQKLSFRLDVAEPKLVFA
KEQQARSEVKAEAGNSATLSCEVAQAQTEVTWFKDGKKLSSSSKVRMEASGCSRRLVVQQ
AGKADAGEYSCEAGGQKLSFHLDVTEPKLVFAKEQQAHSEVKAEAGASATLSCEVAQAQT
EVTWFKDGKKLSSSSKVRMEASGCSRRLVVQQAGKADAGEYSCEAEGQKLSFRLDVAEPK
LVFAKEQQARSEVKAEAGASATLSCEVAQAQTEVTWFKDGKKLSSSSKVRVEASGCSRRL
VVQQAGKADAGEYSCEAGGQKLSFRLDVAEPKLVFAKEQQANSEVKAEAGASATLSCEVA
QAQTEVTWFKDGKKLSSSSKVRVEASGCSRRLVVQQAGKADAGEYSCEAGGQKLSFRLDV
AEPKLAFAKEQQAHSEVKAEAGASATLSCEVAQAQTEVTWFKDGKKLSSSSKVRVEASGC
SRRLVVQQAGKADAGEYSCEAGGQKLSFRLDVAEPKLAFAKEQQAHSEVKAEAGASATLS
CEVAQAQTEVTWFKDGKKLSSSSKVRVEASGCSRRLVVQQAGKADAGEYSCEAGGQKLSF
RLDVAEPKLAFAKEQQAHSEVKAEAGASATLSCEVAQAQTEVTWFKDGKKLSSSSKVRVE
ASGCSRRLVVQQAGKADAGEYSCEAGGQKLFFRLDVAEPKLVFAKEQQAHSEVKAEAGAS
ATLSCEVAQAQTEVTWFKDGKKLSSSSKVRVEASGCSRRLVVQQVGKADAGEYSCEARGQ
KLSFRLDVAEAESQIPERPSRREPLVVKEHETIILTATIAAPSVAAVTWLKDGVEIRRSK
RHEATSLGDTHTLTVRGAQVLDSAIYSCRVGKEGQDFPVQVEEVAAKFSKPLEPVEGELG
GTVMLVCELSPEQAEVVWRCGNTQLRPGKRFQMTSEGPRRTLTVSGLREDDAEEYVCESR
DDRTSARLTVKVPRVVKFTSGLSAMVAEEGQEATFQCVVSPSDAGVTWYKDGMQLQPSEK
FVMVESGASRSLTILGLTLEDAGQVTVEAEGASSSAALRVREAPVLFKKKLEPQTVEERT
SVTLEVELTRPWPEVKWTRNAAVLTPSENVEIRAEGARHCLVLRSVGFADRGFFGCETPD
DKTQAKLNVEMRQVRLVRGLQEVEAKEQGTASMDVELSHAEVEGSWTRDGLRLQPGPKCH
LAVQGPVHILTLSALQPQDSGLVAFRAEGVHTSARLIVTELPVSFTRVLQDVVATQKEKV
TLECELSRPVDVRWLKDGVELRAGKAIGIVAQGTCRSLVIYRCETGDQGVYVCDALDAQT
SASLRVQGRTYTLIFRRVLAEDAGEVKFVAENAESRAHLRVKELPVTLLRPLRDKIAMEK
HRGVLECQVSRASAQVRWFKGGVELQSGPKYEVVSDGLYRKLVINDVQPEDEDTYTCDAG
NVKTSAQFFVEEQSITIVRGLKDMTVMEPAPAWFECETSIPSVRPPKWLLGKTVLQAGGN
VGLEQDGTVHRLTLHKTCSTMTGPVHFTIGKSRSSAQLVVSDIPVVLTRPLEPKAGRELQ
SVVLSCDFRPAPKAVQWYKDDTPLSPSEKFKMALEGQMAELRILRLTPADAGVYRCQAGS
AQSSAEVTVEAREVTVIQPLQDAEAMEEGRVCFSCELSHKDEDIEWSLNGTPLYNDSFHE
ISHEGCLHTLVLKSVRQADTGTVCATSPKVSVSARLVVKGKPVVFLKALDDVSAEERGTL
TLQCEVSDPEARVVWRKDGVELGPSDKYDFLHKAGARGLTVHDLSHEDAGLYTCQVGSKE
TQSKVSVHDLHVGITKRLKTVEVLEGESCSFECVLSHESPSDPAVWTVGGKTVGGSGHFH
AVRQGRKYTLTVKDAALSDAGEVVFSVLGLTSKASLIIRERPVDITKPLEDQRTTLGEDV
MLSCELSRAGTSVRWLKDGKAIRKSQKYDLLSEGTRAVLVVRKASLKDSGEYTCETEASK
STAKLCVEEKANRFTEELADLQVEEKGRAVFTCKTEHPASVVTWRKGLLELRASGKHVPS
QEGLTLKLTINALERTDSDTYTCDIGQARTQARLLVHGQKVRVIEDLEDTAVQEGSSAKF
CCRIAPADYGPVHWFLDKTPLHSNELNEITVQPGGYHVLTLRQLALKDSGTVYFEAGDQR
TSAALRVTEKPSIFSRPLTDVTVTEGEDLTLVCETTTVDSSVRWTKDGKTLRPSARCQLS
HEGCQAQLLITATTPQDGGRYKCEIGGASSSSIVRVHALPVRFRESLKDVEVPEGKAATL
RCVLSSVAAPVEWRHGDDVLKSSNKYSLRQEGAVLELVIRDLQPQDSGQYSCSFGDQTTS
ATLTVKTSSAQFVGKLRNKEATEGTTVTLRCELTKEAPVEWKKGTETLRNGDKYSLKQDG
AVCELQICSLLVADAGEYSCVCGQEKTSATLTVKALLVHFVRRLRSKEATEGDTTTLQCE
LSKAAPVEWRKGTETLRDGDRYSLKQDGAVCELQIRSLTIADAGEYLCTCGQEKTSATLT
VRALPAKFKDSLKNEEATEGTTATLSCELSKAAPVTWKKGPKTLQSGDKYVLRQDGAVCG
LQIHGLTMADAGEYSCVCGQEKTSATLTVRGLPAKFIEDLRSQEATEGATAILRCELSKA
APVEWRKGSETLKDGDRYTLRQDGAVCELQIRGLAVVDTGTYSSLPTKFTEGLRNEEATE
GTMATLRCQMSKAAPVEWRKGSETLRDGDRYSLRQDGAMCELQIRGLTIEDSGEYTCVCG
QEKTSATLSVKALPPRFIEDLRSQEATEGTMATLRCQMSKAAPVEWRKGSETLGDGGRYS
LRQNGAVCELQIHDLAVEDTGEYSCVCGQEKTSATLNVKALPPRFIEDLRSQEATEGTMA
TLRCQMSKAAPVEWRKGSETLRDGGRYSLRQDGAVCELQIHDLDVEDAGQYSCVCGQEKT
SAVLTVDALPPKFTEGLKKEEATEGTMVTLRCQMSKEATVEWRKGAKTLSDGGRYSLRQD
GAMCELQICGLAVEDAGEYSCVCGQEKTSATLSVKALPPRFIEDLRSQEATEGTMATLRC
QMSKAAPVEWRKGSKTLRDGDRYSLRQDGAMCELQICDLAVEDTGDYSCVCGQEKTSATL
SVKAPQVVFQQPLQNLQAEEGSMASLRCELSVPNAAMVWSKGGLELQGDTRREARQQGCV
AELLLRDLRREDAGEYSCTCGSQTTSATLMVTAAPVRFLRELQAQDVDEGATARLRCELS
REAVSVEWRKGSLQLFPCAKYQMVQEGTTAELLVHGVEQEDAGEYTCDAGHTQSIARLSV
RAPKPKFKTDLQSTEQEAGGTARLCCQLSEAEPGTPVQWLKEGVELHVGSKYEMRRQGAV
CELLIHGLEAKDTGEYACLVGGQKTLASLRVKEPEVTIVRGLVDMEVQADEDVEFTCKVS
QAGATDVQWHLQGLPLQSNEVTEVAVLADGCTHVLQLKGVTLEDAGTVSFHVGGLSSSAQ
LTVRVPEVTVLEPLKDVQLSEGQDAHFRCRLSRASGQEARWALGGVPLQCNEMNDITVEQ
GTLYLLTLHKVTLEDAGTITLQVGSCSSEAQLKVTAKNTVLRGLENVDALEGGEALFECQ
LSQPEVAAHTWLLDDEPVHTSEKVEVVYFENGLRHLLLLKNLKPQDSCRVTFLAGDVVTS
AFLTVRALPDPPEDAEVVGRSDHSVTLSWVAPMSDGGGGLCGYRVEMKEASTGQWQLCHD
LVPGPECVVDDLVPGKTYRFRVAAVGPAGAGEPVHLPQMVKIAPAPAPAPAPAPAPAPET
RQAVVGEDICLELEVAADGGEVVWHKGTERIQPGGHFEVLSRGQRQMLVIKGFRTEDQGE
YRCGPIQGLPSSGAATFNVVMTSGSGDEVPAQPSLPPEAAQEGDLHLLWEALARKRRMSR
EPTLDSISELPEEDSRVQHLRQEAEETAPDLSEGYSTADELARTGEADLSHTSSDDESRA
GTPSLVTYLKKAGGPGISPLASKHEAQVTTSVKPQKQQEPVVPTCPPPGDLSAADLMDPS
LDKAAVKIQAAFKGYKVRKEMKQQEGPVFSRTFGDTEAQVGDVLRLECVLATKTDMRACW
LKDGIELTDGRHYHIDQLKDGTCSLLVTGLAPTDSGRYTCQVSTKSGRVSHSACVVVSGT
ESEAESSSGGELDDAFRRAARRLHRLFRTKSPAELSEEELFLSADEGPGEPEEPADWQTY
REDENFVCIRFESLAEARQAVTCFRNMFATMGIGVEISLGEQGPRGVEMRIGKVAPTVTP
AVPLAKTPGLQTSDAAPVFLTELQNQDVQDGYPMSFDCVVTGQPVPSVRWFKDGKLLEED
DHYMINEDQQGGHQLIITAVVPADMGVYRCLAENSMGVSSTKAELRVELTSTDYDTAADA
TETSSYFSAQGYLSSREQEGTESDEGQLPQVLEELKDLQVAPGTRLAKFQLKVKGYPAPK
LYWFKDGQPLTTSDHIRMTDKKTLHTLEIVSVTREDSGQYAAYISNAVGAAYSSARLLVR
GPSEPEEKPASDVHERLVPPRILEKFTPKKVKRGSSITFSVKVEGHPAPSVHWLKEEAEK
GVLWIGPDTPGYTMASSSKQHSLVLLDVGRQHQGTYTCIATNPAGQALCSASLHISGLAK
EEEQERVKEALISSFLQGTSQAVSAQMSESAGFADLVGQSKGESLVAEEAHSHLSLAEVG
TEEFLQKLTSQITEMVSAKISQAKLQVPGGDSDEETKTPSASPRHGRSRPSSSVQESSSE
SEDGDSRGEIFDIYVVTADYLPLGAEQDAIILREGQYVEVLDSAHPLRWLVRTKPTKSSP
SRQGWVSPAYLDKRLKLSPEWGPTEAPEFPGEAVSEDEYRTRLSSVIQELLSSEQAFVGE
LQFLESHHMKHLERSPRVPAAVASQKTVIFRNVQDISHFHSSFLKELQGCGTDDDVAMCF
IKNQEAFEKYLEFLVGRVQAESVVVSTPVQEFYKKYAEETLSAKDPTQPPPPPLQHYLEQ
PVERVQKYQALLKELIRNKARNRQNCALLEQAYAVVSALPQRAENKLHVSLMENYPGTLE
ALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNYLVICKPRRDSRTDTFSYVFRNMM
KLSSIDLNDQVEGDDRAFEVWHEREDSVRKYLLQARTVIIKNSWVKEICGIQQRLAQPVW
RPPEFEEELADCTAELGETVKLACRVTGTPKPIVSWYKDGKPVEVDPHHILIEDPDGSCT
LILDNLTGIDSGQYMCFAASAAGNASTLGKILVQVPPRFVNKVRATPFVEGEDAQITCTV
EGAPYPQIRWYKDGTLLAPGNRYRMLNEPRSGVLVLVIQAASKEDLGHYECELVNRLGST
RGGGELYMQSPALRARDQHHREQIVAAVEGAPSMQVTIEDVQVQVGDMAQFDAVIEGHPP
PIVTWYKGSTQLTSSARLSQRQDGTTYSLVLTDVAPHDAGVYTCVANNAGGQVLCKAELL
VHGGDKLDAENQVYRRKLHSFYDVQEEIGRGVFGFVKRVQHKGNKMFCAAKFIPLRSKTR
AQAYQERDILATLGHPLVTGLLDQFETRKTLILILELCSSEELLDRLFKKGVVTEAEVKV
YIQQLVEGLHYLHSHGILHLDIKPPNILMVHPAREDIKICDFGFAQKITPSEPQYSKYGS
PEFVSPEIIEQNPVSEGSDIWAMGVISYLSLTCSSPFAGESDRATLLNVLEGRVSWSSPT
AAHLSEDAKDFIKATLQRTPRARPSTSQCLAHPWFLKSMPAEEAHFINTKQLKFLLARSR
WQRSLMSYKSILVMRSIPELLQGPPDSPSLGVARHLRGEASGASSSSSSSDNELAPFARA
KSLPPSPVTHSPLLHPRGFLRPSASLPEETEASMPTADAAVPASPQSAGPPASPGCVPRH
SVISSLFYQQAGEGAERGNKTSGAKRHPARRRHLLKGGYIARALPGLREPLMEYSLLEEE
AAREEQASLMTKTPSFETALRLPSSSVREVPGRSHSLDNPPVTTGPSPEACKEQLLFPPS
TGLTHETTAKDRGHKEGFLQESVPFPPMSGDSRPGKQEGSSQDSCRGKPASSCHSELGSG
SQEGCGPPSSQSLGSLPPQSLKKELSTSCGPLFSEQPQAAPFPTQVSPLLGSEKEPQDGS
LSEGPVPVPSSSPGSASQVDASLDTEGLSEAGDTCDFTPPPQRPQEQATTRKFSLESRGG
YAGVAGYGTFAFGGDAGGMLGQGPLWARMAWAVSQSSEEQDEAATESPQPLESLGPIAEA
SGVPLRTSPSLTPWEEVEQVSLVQIRDLSGDAEAADTISLDISEVDPAYLNLSDLYDIKY
LPFEFMIFRRVPKPIEQPESPGSETEAGQGLADFLEEAAWPWPGELGLRAGLEITEEPEE
PGDLEALLGEAAVGRKRKWSPSRGLFQFPGRCLSGEEPVELGLRQRVKASMAHISRILKG
RPEGPEREGPPRKKAGLASFRLSGLKGRDQELSDEAVVLGQSVTLACQVLAQPTAQATWS
KDGVLLESSGHLLISSTLKNFQLLTILVVKEEDLGTYTCCVSNPLGTAVTTGVLRKAERP
SSSPRPEVGELYKDAVLLVWKPVESCGPVTYIVQCCIEGGSWTTLASDISDCCYLTGKLS
RGGMYIFRTACVSKAGMGPYSSPSEQVLLGGPNHLASEEESSRGRPAQLLPSTKTFAFQM
QIRRGRFSVVRQCREKASGRALAAKIVPYQPEDKTAVLREYEALKRLHHPHLAQLHAAYL
SPRHLVLILELCSGPELLPSLAERESYSESDVKDYLWQMLSATQYLHAQHILHLDLRSEN
MMVTEYNLLKVIDLGNAQSLDQEKVPAPENFKDYLETMAPELLEGQGAVPQTDIWAIGVT
AFIMLSGEYPESSEGTRDLQKGLRKGLIRLSRCYAGLSGGAVAFLQSSLCAQPWGRPCAS
TCLQCGWLTEEGPTGSRPTPVTFPTVRLRAFVREREKRRALLYKKHNLAQVR
NT seq 24099 nt   +upstreamnt  +downstreamnt
atggaccactccttcagcggagcaccccgcttcctgacgcggccaaaggcctttgtggta
tctgttggcaaggatgccacgctgagctgccagatcgtgggcaaccccacgccacacgtg
agctgggagaaggaccggcagccagtagaggcaggagcgcgcttccgcctggcccaggac
ggggatgtgtaccgcctcacaattctcgatctggcgctaggtgacagcgggcagtatgtg
tgtcgcgcgaggaacgccataggggaggccttcgccgccgtcggcctgcgagtggactcg
gagggcacgtgtgccgagcaggcgccccactttctgctgcggcccacatccattcgcgtg
cgcgagggcgcagacgccaccttccgatgtcgcgttggaggctcaccacaacctgctgtg
agctggtccaaagatgggcggcgcctgggcccacccgatgccccccatgtgcgtgtggaa
gaacacggggagtcgagcgcgcttcgcatccgttcggcaaggcctcgcgatggtggcacc
tacgaagtccgagcagaaaatccgctgggctctgccagcgctgccgccgctctggtggtg
gactcggacgccgaggttgccggaccacccggcacctccaccgccacgctcctggcgcac
ctgcagcagcggcgggaggccatgcgcgcagagggcatacccccttctccacccggcgct
ggcacgcgcacctgcacggtgaccgaaggcaaacacgcgcgcctcagctgttttgtgacc
ggcgagcccaagcccgagacagtgtggaagaaggacgggcagctggtgaccgagggccgg
cgacacgtagtgtatgaggacgagcaagagaacttcgtccttaagattcttttctgcaag
cagtccgaccgcggcctctacacctgcacagcgtccaacctcgtgggccagacctacagc
tcggtgctggtggtcgtgagagagccgacggtgcccttcaagaagcggctgcaggacctg
gaggtacgagagaaagagtctgctacattccagtgcgaggtggctcagccagctaccgag
gcggcgtggttcaaggaggagacccggctatgggccagcgccaagtacgacatcgaggag
gagggcaccgagcgccggctgaccgtgcgcaacgtctcggcagacgacgacgctgtgtac
atctgcgagaccacagagggcagccgcacggtggcagagctctctgttcaaggaaacttg
accagaaagctgcctcggaagacagcagtgcgcactggagacacagccatcttttgggtg
gagctggctgtccccgaaggccctgtccggtggctacggaaccaggaggagatggtggca
gggggtcgggttgccatcactgcagaaggcacgtgccacacactgaccatcttccagtgc
accttggaggacatgggtgaggtggcctttgtgtctggtggctgccggacgaccacccag
ttctgtgtatcagcgcccaggaggccacccctgtaccctcctgctgaccctgttgtaaag
gccaagacagagagttctgtgaccctcagctggtccgcaccaccccatggggaccgccct
gtcactattgatggctatgtgttggagaagaggaagctgggtgcctatgcctggagcagg
tgtcacgaagctggatggctggccacaactgagtttaccatcactggtgtggctgaggag
ggggatttccagttccgagtgtcagccatcaatcactttggccagggtccttaccttgaa
tttccagggaccatgcacttggtccccatgctggctgtaaagacacctctgaaggcggtg
gaggcagtggagggtggtgaggtcactttctccgtggacctcacggtggcctcttcgggc
gaatggttcctggatggggaggccttgaaagcgagcagtatatacgtgatccgttgtgac
cgcacccggcatatgctcaccatcagagaggtgcccgccagattgcatggggcacagctg
aagtttgtggctaatggcattgaaactagcatccaaatggtggtccgagcggctctgggg
ctgcccagcagtaagcttcctgctgcggctgcccgggaggtgctggcccagttgcacgag
gaggcacagctgctggctgagctgtcggaccaggctgctgctgtgacttggctgaaggat
ggtcgtgagctgtccctagggcccaagtatgagatgcaggtgtcagctgggaggcgagca
ctgctggtgcgggacgtggcacaggatgacgctggcctctatgagtgtgtcagtcgtggg
agccgcactgcctaccagctgttggtgcaagacataacagatggctaccgtgactggggc
ccagcaggacctcagaagcacatgtgcaagtgtgctggggcaaagatagcgagatacttg
ggttcctcttgctaccgcttcttgcagtatgacaagggggtatggcattggctggaggca
gctttggacaccaggcagggcaagggtacctcctcctgctccctgcatgaaaaacccaag
ctggtatttgccaaggggcagcaggcacacagtgaggtgaaggcagaggcgggggccagc
gccacactgagctgcgaggtggcccaggcccagactgaggtgacatggttcaaggacggg
aagaagctgagctccagctcgaaggtgcgcatggaggcctcgggctgctccaggaggctg
gtggtgcagcaggcgggcaaggcggatgctggggagtacagctgcgaggccgggggacag
aagctctccttccgcctggacgtggcagagcccaagatggtgtttgccaaggagcagcag
gcacgcagcgaggtgaaggccgaggcgggggccagcgccacactgagctgcgaggtggcc
caggctcagactgaggtgacatggttcaaggacgggaagaagctgagctccagctcgaag
gtgcgcatggaggcctcgggctgctccaggaggctggtggtgcagcaggcgggcaaggca
gatgctggggagtacagctgcgaggccgggggacagaagctctccttccgcctggacgtc
acagagcccaagctggtgtttgccaaggagcagcaggcacgcagtgaggtgaaggcagag
gtggggaacagtgccacactgagctgcgaggtggcccaggcccagactgaggtgacatgg
ttcaaggacgggaagaagctgagctccagctcgaaggtgcgcatggaggcctcgggctgc
tccaggaggctggtggtgcagcaggcgggcaaggcggatgctggggagtacagctgcgag
gccggggggcagaaactctccttccgcctggacgtggcagaacccaagctggtgtttgcc
aaggagcagcaggcacgaagtgaggtgaaggcagaggcagggaacagtgccacactgagc
tgtgaggtggcccaggcacagactgaggtgacatggttcaaggacgggaagaagctgagc
tccagctcaaaggtgcgcatggaggcctcgggctgctccaggaggctggtggtgcagcag
gcgggcaaggcggatgctggggagtacagctgcgaggccgggggacagaagctctcattc
catctggacgtcacagaacccaagctggtgtttgccaaggagcagcaggcacacagtgag
gtgaaggcagaggcgggggccagtgccaccctgagctgcgaggtggcccaggcccagact
gaggtgacatggttcaaggacggaaagaagctgagctccagctcaaaggtgcgcatggag
gcctcgggctgctccaggaggctggtggtgcagcaggcgggcaaggcggatgctggggag
tacagctgcgaggccgagggacagaagctctccttccgcctggacgtggcagagcccaag
ctggtgtttgccaaggagcagcaggcacgcagcgaggtgaaggcagaggctggggccagt
gccacactgagctgtgaggtggcccaggcccagactgaggtgacatggttcaaggacggg
aagaagctgagctccagctcgaaggtgcgagtggaggcctcgggctgctccaggaggctg
gtggtgcagcaggcgggcaaggcggatgctggggagtacagctgcgaggccgggggccag
aagctctccttccgcctggacgtcgcagagcccaagctggtgtttgccaaggaacagcag
gcaaacagcgaggtgaaggccgaggcgggggccagcgccacactgagctgcgaggtggcc
caggcccagactgaggtgacatggttcaaggacgggaagaagctgagctccagctcgaag
gtgcgcgtggaggcctcgggctgctccaggaggctggtggtgcagcaggcgggcaaggcg
gatgctggggagtacagctgcgaggccggggggcagaagctttccttccgcctggacgtg
gcagagcccaagctggcgtttgccaaggagcagcaggcacacagcgaagtgaaggcagag
gcgggggccagcgccacactgagctgcgaggtggcccaggcccagactgaggtgacatgg
ttcaaggatgggaagaagctgagctccagctcgaaggtgcgcgtggaggcctcgggctgc
tccaggaggctggtggtgcagcaggcgggcaaggcggatgctggggagtacagctgcgag
gccgggggacagaagctctcattccgcctggacgtggcagagcccaagctggcgtttgcc
aaggagcagcaggcacacagcgaggtgaaggcagaggcgggggccagcgccacactgagc
tgtgaggtggcccaggcccagactgaggtgacatggttcaaggacgggaagaagctgagc
tccagctcgaaggtgcgcgtggaggcctcgggctgctccaggaggctggtggtgcagcag
gcgggcaaggcggatgctggggagtacagctgcgaggccgggggtcagaagctctccttc
cgcctggacgtggcagagcctaagctggcgtttgccaaggaacagcaggcacacagcgag
gtgaaggcagaggcgggggccagtgccacactgagctgcgaggtggcccaggcccagact
gaggtgacatggttcaaggacgggaagaagctgagctccagctcgaaggtgcgcgtggag
gcctcgggctgctccaggaggctggtggtgcagcaggcgggcaaggcggatgctggggag
tacagctgcgaggccgggggacagaagctcttcttccgcctggatgtggcagagcccaag
ctggtgtttgccaaggagcagcaggcacacagtgaggtgaaggccgaggcgggggccagc
gccaccctgagctgcgaggtggcccaggcccagactgaggtgacatggttcaaggacggg
aagaagctgagctccagctcgaaggtgcgcgtggaggcctcgggctgctccaggaggctg
gtggtgcagcaggtgggcaaggcggatgctggggagtacagctgcgaggccaggggacag
aagctctccttccgcctggacgtggcagaggccgaatcccagattccggagagacccagc
cgcagggaacctctggttgtcaaggaacatgagaccattatcctgactgccacaatagct
gcaccctctgtggctgctgtgacctggctcaaagatggagtggagatccgccgcagtaag
cggcatgaggccaccagtctgggtgatacccataccctgaccgtgagaggcgcacaggtc
ctggacagtgccatctacagctgccgtgttggcaaggaaggtcaggacttcccggtgcag
gtagaagaggtggccgccaagttctccaaacccctggagcccgtcgaaggggagctgggt
ggcaccgtgatgctggtttgtgagctgagcccggagcaggctgaggttgtgtggcgctgt
gggaacacacagctgcggccaggcaagcgcttccagatgacatcagaggggcctaggcgc
acgctgaccgtgtctggccttcgagaggatgacgcagaggagtatgtgtgtgagagccgg
gatgaccgcaccagcgcacggctcactgttaaagttccccgagtggtcaagtttacgtct
ggattgagtgccatggtcgcagaggagggccaagaggccacctttcagtgtgtcgtgtcc
cccagcgatgcaggggtcacatggtacaaggacgggatgcagctgcagcctagcgagaag
tttgttatggtagagagtggggccagccgcagcttgactatcttgggcctgaccctggag
gatgccggtcaagtcacagtggaggctgagggggcttcatcttctgctgccctccgggtc
cgagaggcaccggtcctcttcaaaaagaagctggagccacagacagtggaggagaggacc
tctgtgacattggaggtggagctgacgcggccctggcccgaggtgaagtggacacggaat
gctgccgtcctgacacccagcgagaacgtggagatccgcgctgagggtgctcggcactgt
ctggtgctgcgcagcgtgggctttgctgaccgcggcttctttggctgtgagacaccagat
gataagactcaggccaagctcaatgtagaaatgcggcaggtccggctggttcgcggtctg
caggaggtggaggctaaggaacagggcacggcctcgatggatgtggagctgtcccatgcc
gaggtggagggcagctggacccgagatggcctgcgacttcagcctggacccaaatgccac
ctggccgtacaaggccctgtccacatcctcacactctcggcgctgcagccacaggacagt
gggctggtggccttcagggccgagggcgtgcacacgtctgcgaggctcatagtcactgag
ttgcccgtgagcttcaccagagtactacaggatgtggtggccacgcagaaggagaaggtc
accctggagtgtgagctgtcgaggcctgtggatgtgcgctggctgaaggatggtgtggag
ctgcgggcaggcaaggccataggcatagtggcccagggaacctgcaggagtctcgttatc
taccgctgtgagactggggaccagggtgtctatgtatgtgatgctcttgatgctcagacc
tctgcctctctgagggtgcaagggaggacatacacgcttatcttccggagggtactggca
gaggatgcaggggaggtcaagtttgtagctgagaacgcagaatcaagagctcacctccga
gtgaaagaactgcccgtgaccctcctgcgcccactgagggacaagattgccatggaaaaa
caccgtggagtgctggagtgccaggtgtcccgggctagtgcccaggtgcggtggttcaag
ggcggagtcgagctgcagtctgggcccaagtacgaggtggtcagtgacggcctttaccgc
aagctggtcattaatgacgtgcagcctgaggatgaagatacgtacacctgtgacgctggc
aacgtcaagaccagtgcccagttctttgtggaagagcaatccatcactattgtgcgggga
ctgaaggacatgacagtgatggagcctgcccctgcctggtttgaatgtgagacatccatc
ccttccgtgaggccacccaagtggctccttggtaagactgtgctccaggcaggggggaac
gtgggactggagcaagacggcaccgtgcaccggctgacactgcacaagacctgctctacc
atgaccgggcctgtgcacttcactatcggcaagtcccgctcctctgcccagctggttgtc
tcagacattcctgtggtactgacacggcctctggagcccaaagcagggcgtgaactgcag
tcagtagtcctgtcctgtgacttcaggccagcccccaaggctgtgcagtggtacaaggat
gacacacccctgtccccgtcagaaaagttcaagatggcgctggagggccagatggcagag
ctgcgcatactccggctcacgccagctgatgctggggtctaccggtgccaggcgggtagc
gcccagagcagtgctgaggttactgtggaagctcgggaggtgacagtgattcagccactg
caggatgcagaagccatggaggaaggccgggtctgcttctcctgcgagctgtcccataag
gatgaagatatcgaatggtcactcaatggtacacccctgtacaatgacagcttccatgag
atcagccatgagggctgtctccacaccctggtgctgaagagtgtccggcaggctgacaca
ggcaccgtgtgcgccacctcccccaaggtgtccgtttccgcccggctggtggttaaaggc
aagccagtggtgttcctgaaagcactggatgacgtatctgcagaagagcgtggcacgctg
accctgcaatgcgaggtctccgaccccgaggcacgcgtggtttggcgcaaagatggtgtg
gagcttggtcccagcgacaagtatgatttcctacataaggcaggtgcccggggccttacg
gtccatgacctgagccatgaggatgctggactgtacacctgccaggtgggcagtaaggag
acccagtccaaggtcagcgtacatgatcttcacgtgggcatcaccaagaggttaaagaca
gtggaggtgctggagggagagagctgcagctttgagtgtgtcctttcccacgagagtccc
agtgacccagcagtgtggacggtcggtgggaagacagtgggtggttctggccactttcac
gccgttcggcagggccgcaaatacaccctgacagtcaaagatgctgcactcagtgatgca
ggagaggtggtcttctcggtgctgggcctcacttccaaggcctcgctcatcatcagagag
aggccagtggacatcaccaagcccctggaggaccagcggacgacgcttggggaagatgta
atgctaagctgtgagctgtccagggcaggcacctctgtgcgctggctgaaagacgggaag
gccatcaggaagagccagaagtatgacctgctcagtgaaggcacgcgggctgtgttggtt
gtccgcaaggcctcactcaaggattcaggggaatacacctgcgagacagaagcttcgaaa
agcactgccaagctctgtgtggaagaaaaggcaaaccggttcacggaggagctggctgac
ctgcaggtggaagagaagggcagagctgtgttcacatgcaagacagagcacccagcatct
gtcgtgacctggcgcaaaggcctcctggagctgcgcgcctcagggaagcatgtccccagt
caggaaggcttgaccctgaagctcaccatcaacgccctggagaggacagacagtgacact
tacacctgtgacatcggccaagcccggacccaggcacggctcctcgtccacggccagaaa
gtgcgcgttattgaggacctagaggacactgctgtccaggagggctcctctgctaagttt
tgctgccgcatcgctcctgctgactacggccccgtgcactggttcctggataagaccccc
ttgcacagcaatgagctgaatgagatcactgtccagcctggaggctatcacgtgctcacc
ctgcggcagctggcactcaaggactcaggcactgtctactttgaggcgggtgaccagcga
acctcagctgccctgcgggtgactgagaagccgagcatcttctctcggccactcacagac
gtcacagtcacagaaggcgaggacctgactctggtctgtgaaaccaccactgtggatagc
tctgtgcgctggaccaaagatgggaagacactgaggccgtctgcacgatgccagctgagc
catgaaggctgtcaggcccagctgctcatcactgccaccaccccacaagatggtgggcgg
tacaaatgtgagattggtggagcctccagcagctccattgtcagggtccatgctctgcca
gtgcggttcagggagtccctgaaggacgtggaggtaccagagggcaaggccgccacactg
cgctgtgtgctgtcatccgtggctgcacctgtggagtggcgtcatggagatgatgtcctg
aaatccagcaacaagtatagcctgcgccaagagggtgctgtgctggaattggtcatccga
gacctgcagccccaggacagtgggcaatactcatgctcctttggggaccagacaacttca
gccacactcacagtgaaaacctcttctgcccagttcgtagggaaactgagaaacaaggag
gccacagaagggaccacggtcacacttcggtgtgagctgaccaaagaggcccccgtggag
tggaagaagggaacagagaccctgagaaatggggacaaatacagtctgaagcaggatgga
gctgtgtgtgagctgcagatctgtagtctgctggtggcagatgcaggggagtactcgtgt
gtgtgtgggcaggagaagacttcagccacgctgactgtcaaggctctgcttgtccacttt
gtcagaaggctcaggagcaaggaggccacagaaggagacacgaccacactgcagtgtgaa
ctgagcaaggctgcccccgtggagtggaggaagggaacagagaccctgagagatggggac
agatacagcctgaagcaggatggggctgtgtgtgagctgcaaatccgcagcctgaccata
gcagatgctggcgagtacttgtgcacgtgtggacaggaaaagacctcagccacgctgacc
gtcagggcccttccagctaagttcaaagacagtctgaagaatgaagaggctacagaaggc
accacagctacactgagctgtgaactgagcaaggcagctccggtgacatggaagaaagga
ccgaagaccttgcaaagtggagacaaatatgtcctgaggcaggatggagctgtgtgtgga
ctacagatccatggcctgaccatggctgatgctggggagtactcgtgtgtgtgtgggcag
gagaagacgtcagccacgctgactgtcaggggcttgcctgccaaatttatagaagatctg
agaagccaagaagccacagaaggggccacagcaatcttaagatgtgagctgagcaaggct
gctcctgtggagtggaggaaagggtctgagaccctgaaagatggggacagatacaccctg
aggcaggatggggccgtatgtgagctgcagatccgtggcctggctgtggtggatactggg
acatactcgtccctgcccaccaagttcacagagggtctgaggaatgaagaggccacggaa
ggcaccatggccactctgaggtgccagatgagcaaggctgcccctgtggagtggaggaag
gggtcagagaccctgagagatggggacagatacagcctgaggcaggatggggccatgtgt
gagctgcagatccgtggcctgaccatagaagattctggggagtacacatgtgtgtgtggg
caggagaagacgtcagccacactgagtgtcaaggctctgccccccagattcatagaagac
ttgagaagccaagaggccacagaaggcaccatggccactctgaggtgccagatgagcaag
gcagcccctgtggagtggaggaaggggtctgaaaccctgggagatgggggcagatacagc
ctgaggcagaatggtgctgtgtgtgagctgcagatccatgacctggctgtggaagacact
ggggagtactcatgtgtgtgtgggcaggagaagacctcagccacactgaatgtcaaggcc
ctgccccccagattcatagaagacttgagaagccaagaggccacagaaggcaccatggcc
actctgaggtgccagatgagcaaggcagcccctgtggagtggaggaaggggtctgagacc
ctgagagatgggggcagatacagcctgaggcaggatggggctgtgtgtgagctgcagatc
catgacctggatgtggaagatgctggccagtactcgtgcgtgtgtgggcaggagaagacc
tcagccgtgctgactgtagatgcactgccccccaagtttacagagggtctgaagaaggaa
gaggccacagaagggaccatggtaacactgaggtgccagatgagcaaagaagccacggtg
gagtggaggaagggagcaaagaccctcagcgatgggggcagatacagcctgaggcaggat
ggggccatgtgtgagctgcagatctgtggcctggctgtggaagacgctggggaatactca
tgtgtgtgtgggcaggagaagacctcagccacactgagtgtcaaggccctgccccccaga
ttcatagaagacttgagaagccaagaggccacagaaggcaccatggccactctgaggtgc
cagatgagcaaggctgcccctgtggagtggaggaagggatccaagaccctgagagatggg
gacagatacagcctgaggcaggatggggccatgtgtgagctgcagatctgtgacctggct
gtggaagacactggggactactcatgtgtgtgtgggcaggagaagacctcagccacactg
agtgtcaaggctccacaggtggtattccagcagccactgcagaatctgcaagcagaagaa
ggctccatggccagcctgcggtgtgagttgtcagtccccaacgctgccatggtctggagc
aagggtggtctggagctgcagggtgacacgcgccgagaggcacggcagcaggggtgtgtg
gcagagctgttgcttagggacctgcgtcgcgaggatgcgggcgagtacagttgcacctgt
ggctctcagaccacaagcgccacgctcatggtcacagctgctcctgtgcggttcctccgg
gaactgcaggcccaggacgtagatgagggggccaccgcacgcctgcgctgtgagctgagc
cgggaggctgtgagcgtggagtggcgcaagggctccttgcaactttttccttgtgctaag
tatcagatggtgcaggagggcacaactgcggagctgctggtccatggggtggagcaggag
gatgcaggcgaatacacctgcgatgcaggccacacgcagagcattgccaggctctctgtc
cgagcccccaagcccaagttcaagaccgacctgcaaagcacagagcaggaagcaggtggc
acggcacggctgtgttgtcaactgagcgaagctgagccagggactccagtgcagtggctc
aaggagggggtggagctgcacgtcggctccaagtatgagatgcggcgccaaggggctgtg
tgcgagctgctgatccatgggctggaggccaaggacactggagaatatgcctgcctggtg
ggtggccagaagaccttggcctccctcagagtcaaagagcctgaggtgaccatcgtgcgg
ggactcgtggacatggaggtgcaggccgatgaggatgtggagttcacttgcaaggtgtca
caggcaggagccacagacgtgcagtggcacctccaaggtctgccactgcagagcaatgaa
gtgacagaggtggctgtccttgcggacggctgtacccatgtgctccagttaaagggtgtg
acactggaggatgctggtactgtctccttccacgtgggcggcctttcatcttctgctcag
ctcacagtccgagtccctgaggtgaccgttctggagcccctgaaggatgtgcagctcagc
gagggccaggatgcccacttccggtgccgactgtccagggcctcgggccaggaggctcgc
tgggctttgggaggggttcccttgcagtgcaacgagatgaacgacatcactgtggagcag
ggcacactctacctgctcactctgcacaaggtgaccctggaggatgctgggaccatcact
ctccaagtgggctcatgctcctcagaggcccagctgaaggtcacagccaagaacacggtg
ttgcgtggcctggagaacgtggatgcactggagggcggtgaggctctgttcgagtgccag
ctgtcccagcctgaagtggccgcccacacctggctgctggacgacgagcctgtgcacacg
tcggagaaggtggaggtggtctactttgagaacggactgcggcacctgcttctactcaaa
aacctgaagccacaggacagctgccgagtgaccttcctggcaggggatgtggtcacgtcc
gcattcctcactgtgagagctcttcctgacccccctgaagatgctgaagtggtggggcgt
agtgaccattctgtgaccctatcctgggtggctcccatgagtgatggaggtgggggtcta
tgtggttatcgtgtggagatgaaggaggcatccacaggccagtggcagttgtgccatgac
ttggtacctggtccagagtgcgtggtggacgacctggtccccgggaagacctaccgcttc
cgagtggcagctgtgggtccagcaggtgctggggagcctgtacacttgccccagatggtc
aagatagccccagccccggccccggccccggcccctgccccagcccctgccccagaaaca
cggcaggcagtagttggtgaagacatctgtctggagttggaagtggcagctgatggtggc
gaggtcgtctggcacaagggaacagagcgcatccagcccggagggcactttgaggtcctc
tctcggggtcagcggcagatgctggtgatcaagggctttaggaccgaagaccaaggggag
taccgctgtggtcccattcagggtctgccctcctcaggagctgccacgttcaatgtggtc
atgacctcaggctctggggatgaggtcccggcacagcctagcctgcctcccgaggcagcc
caggagggtgacctgcatctgctttgggaggcccttgcccggaagcgccgcatgagtcgg
gagcccacgctggactccatcagtgagctgcctgaggaagacagccgtgtgcagcatctg
cggcaggaggcagaagagacagctcccgacctctctgaaggctactctacagcggatgag
ctagcacgcacaggagaggccgacctctcacacaccagctctgacgatgagtctcgggct
ggcaccccttccctagttacctacctcaagaaggccgggggtcctgggatctcacccttg
gccagcaagcatgaggcccaggtgaccacgtctgtgaagccacaaaagcagcaggagcca
gtcgtgcccacgtgcccaccgccgggagacttgagtgcagcagatttgatggatccatcc
ctggacaaggctgctgtgaagattcaggctgcctttaagggttacaaagtgcggaaggag
atgaaacagcaggaagggcctgtgttctcacgaacatttggggacacagaggcacaggtt
ggggatgtgctgcggctagagtgtgtgctggccaccaagactgatatgcgggcctgctgg
ttgaaggatggcatcgagttaacagatgggcgccattaccacatagaccagctcaaggat
ggtacctgctctctgctggtcactggcctggcccccactgactctggccgttacacctgt
caggtgagcaccaagtctggccgtgtgagccacagtgcctgcgtggtggtcagtgggaca
gagagcgaggccgagagctcctctgggggcgagctggatgatgctttccgccgggcagcg
agacgcctgcaccgcctcttccgcaccaagagcccagctgagctttcagaggaggaactc
ttcctcagcgctgatgaaggccccggggagccagaggagcccgcagactggcaaacatac
cgagaggatgagaactttgtgtgcatccgttttgagtcccttgcagaggcccgccaggca
gtcacctgcttccgaaacatgtttgccactatgggcatcggggtggagatcagcctaggg
gagcagggaccccggggagtggagatgcgcatcggcaaggtggcccctactgtcacccct
gcagtgccgcttgcaaagacacctggcctgcagacttcagatgctgccccagtgttcctg
accgagctgcagaaccaagatgtgcaggatggataccccatgagcttcgactgcgtggta
acgggccagcctgtgcccagtgtgcgctggttcaaggatgggaagctgctagaagaggat
gaccactatatgatcaatgaggaccaacaggggggtcaccagctcatcatcacagctgtg
gtgccggcagacatgggtgtctaccgctgcctggcggagaacagcatgggcgtctcctcc
accaaggctgagcttcgtgtggaattgaccagcacagactatgatactgctgcggatgct
actgagacctcatcctacttcagcgcccagggatacctgtccagtcgggagcaagaggga
acggagtcagatgaggggcagcttccccaggtgctggaggaactgaaagacctccaagtg
gcccccgggacacgcctggccaagttccagctcaaggtgaaaggctatccagctcccaaa
ctgtattggttcaaagatggccagcccctgaccacgtctgaccacatccgcatgactgac
aagaagaccctgcacaccctggagattgtctcggtcactcgggaggacagcggccagtat
gcagcctacatcagcaatgctgtgggtgctgcctattcgtcagcccggcttctggtccga
ggtcccagtgaaccagaagagaagccagcatcagatgttcatgagaggctggtgccaccc
cgaatcctggagaagttcacccccaagaaagtgaagaggggctccagcatcaccttttca
gtgaaggtggaaggacacccggcccccagtgtgcattggctcaaggaggaggcagagaag
ggagtcctgtggattggccctgacaccccgggctacaccatggccagctcttccaagcag
catagcctggtcctgctggacgtaggccgacagcaccagggcacctacacatgtattgct
accaaccctgctggccaggcgctctgctctgccagcctgcacatctctggcttggccaaa
gaagaagagcaggagagagtgaaggaggccctcatttcctctttcctgcaagggacaagc
caagctgtctcagcccagatgtcagaatccgcaggttttgctgatcttgtcgggcaaagc
aaaggcgagtctctggtggctgaggaggcccacagtcacctgtcccttgctgaggtgggc
actgaagagttcctgcagaaactcacctcgcagatcacggagatggtatcggccaagatc
tctcaggccaaactccaggtgcctggaggtgacagcgatgaagagaccaagacaccatct
gcttctcctcggcatggccggtcacgtccttcctccagtgttcaagagtcctcctcagag
tcagaggatggggactcccgtggtgagatctttgacatctatgtggtcacagctgactat
ctgccactgggagctgagcaggatgccatcattctgagagaaggccagtatgtggaggtc
cttgactctgcccatcccctgcgctggcttgtccggaccaagcccaccaaatccagtcct
tccaggcagggctgggtgtcacctgcctacctggataagaggctcaagctgtctcctgag
tgggggcccactgaggcccccgagttccctggcgaggctgtgtctgaggatgagtataga
acgaggctgagctctgtcatccaggagttgctgagttcagagcaggcttttgtgggtgag
ctgcagttcttggagagccaccacatgaagcacctggagcgatctccccgagtacccgca
gctgtggccagccagaagacagtcatctttcgtaatgtgcaggacatcagccatttccac
agcagcttcttgaaggagctgcagggctgtggcaccgacgatgatgtggccatgtgcttc
atcaagaaccaggaggcctttgagaagtacctcgagttcctggtgggccgcgtgcaagct
gaatcagtggttgtcagcaccccagtccaggagttctacaagaaatatgcagaagagaca
ctgtcagccaaggaccccacacagccacccccacctcctcttcagcactacctggagcag
ccagtggaacgggtgcagaaataccaggccttgctgaaggagctaatccgcaacaaggcc
cgcaaccggcagaactgcgcgctgctggagcaggcctatgctgtggtgtctgccctgcct
cagcgcgccgagaacaagctgcacgtttctctcatggagaactacccaggaaccctggag
gccctgggagaacctatccgccagggccacttcatagtgtgggagggggccccaggggcc
cggatgccttggaagggccacaaccggcacgtcttcctcttccgaaactacctggtgatc
tgcaagccccgaagagactctcgaaccgacaccttcagctatgtgttccggaacatgatg
aagctgagtagcatcgacctgaatgaccaagtagagggggatgaccgcgcctttgaggtg
tggcacgaacgggaagactctgtgcgcaagtacctgctgcaggcacggaccgtcatcatc
aaaaactcctgggtgaaggagatctgtggcatccagcagcgcctggcccagcctgtgtgg
cgtccccctgagtttgaagaggaactagcggactgcacagccgagctgggtgaaacggtc
aagctagcatgccgagtgacgggcacacctaagcctattgtcagctggtacaaagatggg
aagccagtggaggtggacccacaccacatcctcattgaagaccctgacggctcctgcacc
ctcatcttggacaaccttactggcatagactctggccagtacatgtgttttgcggccagt
gctgctggcaacgccagcaccttggggaagattctagtacaagtgcccccacggtttgtg
aacaaggtccgggccacaccctttgtggagggagaggatgcacagatcacctgcacagtg
gaaggagccccgtaccctcagatcaggtggtacaaggatggtaccctgctagccccgggc
aacaggtaccggatgttgaatgaaccccgcagtggtgtgctggtgctggtgatccaggcg
gccagcaaggaggacctgggacactatgaatgtgagttggtgaaccggttgggctcaaca
cgtggtggtggagaactatacatgcagagccctgcactgcgtgcccgggaccagcaccac
cgggaacagattgtggctgccgtagaaggggccccgtccatgcaggtcactattgaggat
gtacaagtacaagtaggggacatggcacagtttgatgctgtcattgaaggccacccacca
cccatagtaacctggtacaagggcagcacccagctgacgagcagtgcccggctgagccaa
cggcaagatggaacgacatactccttggtgttgactgacgtggctccacacgatgccggt
gtctacacatgtgttgccaataatgcaggtggacaggtgctctgcaaggcagagctgctg
gtccatgggggggacaagctagatgccgaaaatcaagtctatcggagaaaactgcattcc
ttctatgacgttcaagaagagattgggaggggtgtgtttgggtttgtgaaaagggttcag
cacaaaggaaacaagatgttctgtgccgccaagttcatccccctacggagtaaaactcgg
gcccaggcataccaggaacgagacatcttggctacactcggccacccactggtcactggg
ctcctggatcaatttgagacccggaagactctcatccttatcttggaactgtgctcgtct
gaggagctgctggatcggctcttcaagaagggtgtagtgactgaagccgaggtcaaagtc
tatatccagcagctggtggaaggcctacactatttgcacagccatggtatcctccacctg
gacataaagccccccaacatcctgatggtgcacccagctcgggaagacatcaagatctgt
gactttggctttgcccaaaagatcaccccttcagagccacagtacagcaagtatggctca
cccgaattcgtgtccccagagatcattgagcagaatcctgtgagcgagggctcagacatc
tgggccatgggcgtcatctcctacctcagcctcacctgctcatccccatttgctggagag
agtgaccgcgccaccttgctcaatgttttggaggggcgggtctcctggagcagtcccacg
gctgctcatctgagtgaggacgccaaggacttcatcaaggccacgctgcaaaggaccccc
agggccaggcctagtacttcccagtgccttgcccacccctggttcctgaaatccatgcct
gctgaggaggcccacttcatcaacaccaaacagctcaagttccttcttgctcgaagtcgc
tggcagcgttccttgatgagctacaagtctatcctggtgatgcgctccatccctgagctg
cttcagggtcccccagacagtccatctctaggagtggcccggcacctacgaggggaagcc
agtggcgcctctagctcatcatcttcctcagacaacgagcttgccccatttgccagggct
aagtcgctgccaccttctcctgtgactcactcgccactgctgcaccctcggggctttctg
cggccttcggccagcctcccagaggagacagaggccagcatgcccactgctgatgcggcc
gtgccagcgtccccacagagtgctgggcctccggcaagcccaggttgtgtgccccggcac
agcgtcatcagcagcctgttctaccagcaagctggcgagggtgcagagcgtgggaacaaa
acatcgggtgccaagaggcaccctgcgcggaggcggcacctgctaaagggtgggtacatt
gcaagggccttacccggtctgcgtgagcccctcatggagtacagcttgttggaggaagag
gcggctagggaagagcaggcctctctgatgaccaagacaccctcctttgagactgccctg
cgactacctagttccagtgtcagagaggtcccaggccgaagccactccctggacaaccca
ccagtcacgactggcccctctcctgaggcatgcaaggaacaactcctgttcccaccctcc
acggggttgactcatgaaaccactgccaaggacagggggcacaaagaggggttcttgcag
gagtctgtcccctttccacctatgagtggtgactcgaggcctgggaagcaagagggatca
tcccaggacagttgtagagggaaaccagcctcttcctgtcactctgagctgggttctggt
tcccaggagggctgtggccctccatcatctcaatcgcttggctccttacctccacagtca
ttgaagaaggagctctcaacgtcctgtggcccactcttttcagaacagcctcaggcagcc
ccattcccaactcaagtaagcccccttctgggttctgagaaggaacctcaggatggctct
ctatctgaagggccagttccagttccctccagttctccagggtcagcttcccaagtagat
gcatccttggatactgaaggcttgtctgaagctggggacacatgtgacttcacgcctcct
ccacagcggcctcaggagcaggccaccacccggaagttctctctggagtcccgtgggggc
tatgcaggggtggcaggctatggtacttttgcctttggcggggatgcaggggggatgcta
gggcagggtcctctctgggccaggatggcctgggctgtgtcccagtcctcagaagagcag
gatgaagctgcgactgagagccctcaacctctggagagcttggggcccattgctgaggcc
agtggggttcccctaaggacctctccaagcctcaccccttgggaggaagttgagcaggtt
tccctggtgcagatccgggatctgtctggtgatgcggaagcagctgacactatctccttg
gacatttctgaggtcgatcctgcctacctcaacctctcggatctatatgacatcaaatat
ctcccatttgagttcatgatcttcagaagggtccccaaacctatagagcagccagagtca
cctggctcagaaaccgaagctgggcaagggctggcagatttcctggaggaggccgcgtgg
ccctggccaggcgagctgggactgcgtgctggtctggagattacagaggagccggaggag
ccaggggacctggaagcactgctgggcgaggctgctgtgggcaggaagcgcaagtggtcc
ccctcccggggcctcttccaattccctgggaggtgcctgtcaggggaggagcctgtggag
cttgggctgcgccagagggtgaaggcttccatggctcacatctccaggatcctcaagggc
aggccggaaggtcctgagagggaagggcctcccagaaagaaggcaggcctagcttctttc
cggctgtcaggcctgaagggcagggaccaagaactctcagacgaggctgtggtcctgggc
caatcagtgacactggcctgccaggtgttggcccagccaactgcccaggctacctggagc
aaagatggggtcctcctggagagcagcggccacctcctcatctcctccaccctgaagaac
ttccagctgctgaccatcctggtggtgaaagaggaggatctgggcacatatacctgctgt
gtgagcaacccgctggggacagcagtcaccacaggtgtcctccggaaagcagagcgccct
tcatcttctccacgccctgaggtgggggaactatacaaggatgcggtgctgctggtctgg
aagcctgtggaatcctgtggcccggtgacctacattgtgcagtgctgtatagaaggaggc
agctggacaaccctggcttcagacatctctgactgctgctacctcactggcaagctatcg
aggggtggcatgtatatcttccggacagcatgtgtcagcaaagcaggaatgggcccctac
agcagcccctcagaacaggtcctcctcggaggacccaaccacctggcctctgaggaggaa
agcagccgggggaggccagcccagcttctccccagcacaaagacctttgccttccagatg
cagatccggaggggccgcttcagtgtggtgcggcagtgcagggagaaggcaagtgggcgg
gccctagctgctaagatcgttccctaccaacctgaggacaagacagctgtactaagagaa
tacgaggcacttaagagactgcaccacccacatctggcccaactccatgccgcctacctc
agtccccggcacctggtgctcatcctggagctgtgctctggccctgagctgctaccctct
ttggcagagagggaatcctactcagagtctgatgtgaaggactacctgtggcagatgctg
agtgccacccagtacctgcatgcccaacacatcctgcacctggacctgaggtccgagaac
atgatggtcactgagtacaacctgcttaaggttatagacctgggaaatgcccagagtctc
gaccaagagaaggtcccagcccctgagaacttcaaagactacctggagaccatggctcca
gaactcctggaaggtcaaggggctgttccacagacagacatttgggctattggtgtaaca
gccttcattatgctgagtggcgagtacccagagagcagcgaggggactcgcgacctgcag
aaaggcttgcgcaagggactcattcggttgagtcgctgctatgcaggattatcaggagga
gccgtagccttcctgcagagttcattatgtgctcaaccctggggccgcccgtgcgcttcc
acctgcttgcaatgcggatggctgacagaggagggccccaccggctcccggcccacgccc
gtaaccttccccaccgtgcggttgcgcgcctttgtgcgcgagcgcgagaagcggcgtgcg
ctcctctacaagaagcataacctggcccaggtgcgctga

DBGET integrated database retrieval system