KEGG   Mus musculus (mouse): 53869Help
Entry
53869             CDS       T01002                                 

Gene name
Rab11a
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04962  Vasopressin-regulated water reabsorption
mmu04972  Pancreatic secretion
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    53869 (Rab11a)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    53869 (Rab11a)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    53869 (Rab11a)
   04961 Endocrine and other factor-regulated calcium reabsorption
    53869 (Rab11a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    53869 (Rab11a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    53869 (Rab11a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    53869 (Rab11a)
   04031 GTP-binding proteins [BR:mmu04031]
    53869 (Rab11a)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    53869 (Rab11a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   53869 (Rab11a)
  Exosomal proteins of colorectal cancer cells
   53869 (Rab11a)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    53869 (Rab11a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 Gtr1_RagA FeoB_N ABC_tran PduV-EutP SRPRB AAA_14 AAA_24 TniB FAD-SLDH MCM AAA_7 AAA_5 AAA_21
Motif
Other DBs
NCBI-GeneID: 53869
NCBI-ProteinID: NP_059078
MGI: 1858202
Ensembl: ENSMUSG00000004771
Vega: OTTMUSG00000036848
UniProt: P62492 Q0PD45
Position
9; 9 C
AA seq 216 aa AA seqDB search
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaacctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagtaccattggagtagagtttgcaacaagaagcatccaggttgatgggaaaacaata
aaggcacagatatgggacacagcagggcaggagcggtacagggctataacgtctgcatac
tatcgtggagcagtaggtgccttattggtttatgacattgctaagcatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatttacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagagaagaatggtttgtcattcattgagacatctgctctagattctacaaat
gttgaagctgcttttcagacaattctaacagagatataccgcattgtttctcagaagcaa
atgtcagacagacgtgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccgcccaccactgagaacaagccaaaggtgcagtgctgtcagaacatctaa

DBGET integrated database retrieval system