KEGG   Mus musculus (house mouse): 76877
Entry
76877             CDS       T01002                                 
Symbol
Rab36, 6330593L16Rik, AW047545
Name
(RefSeq) RAB36, member RAS oncogene family
  KO
K07922  Ras-related protein Rab-36
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    76877 (Rab36)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab34/36
    76877 (Rab36)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA PduV-EutP AAA_14 SRPRB
Other DBs
NCBI-GeneID: 76877
NCBI-ProteinID: NP_001346199
MGI: 1924127
Ensembl: ENSMUSG00000020175
Position
10:74872727..74890580
AA seq 267 aa
MRSSWTPLGPPVSQDRIITSFPKWYTPDACLQLKEHFHSRVSTACQHRNTGTAGLRLSKV
VVVGDLYVGKTSLIHRLCKNVFDHDYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFK
CIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDVLRENEAGSCFIFLVGTKKDLLSGAA
CEQAEAEAVHLANEMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLEKRPSTQSQV
GDGDGDLIRIEVPKTQENKRPPGLGCC
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaggtcctcttggacccctttggggccccctgtgagccaggaccgcatcatcaccagc
ttccctaagtggtacacgccggatgcctgcctgcagctcaaagagcacttccacagccgc
gtcagcacagcctgccagcacaggaacacaggcactgctgggctcagactctccaaggtg
gtggtcgttggcgatctctacgtgggaaagactagcctcattcacaggttgtgcaagaat
gttttcgaccatgattacaaggccacgatcggcgtggactttgaaatcgagcgctttgag
atcgcagggattccctacagcctccagatctgggacacagccgggcaggagaagttcaag
tgtattgcgtctgcctactaccgcggtgcccaggtgatcatcacagcctttgacctcact
gacgtgcagactctggaacataccaggcagtggctggaggacgtgctgagggagaatgag
gcaggctcctgcttcatcttcctcgtgggaaccaagaaggatctcctgtcgggggcagcg
tgcgagcaagcggaagctgaggctgtgcatctggccaatgagatgcaggcagagtactgg
tctgtgtcagctaagacgggagagaatgtgaaggcattcttcagccgcgtcgccgcccta
gcctttgaacagtctgtacttcaggacctagagaagaggcccagcacccagtcccaggtc
ggagatggagatggagacctaatacgaatagaggtacccaaaacccaggagaacaagagg
ccgcccggcctaggctgctgttaa

DBGET integrated database retrieval system