KEGG   Mesorhizobium opportunistum: Mesop_2836
Entry
Mesop_2836        CDS       T01542                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mop00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mesop_2836
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mop02044]
    Mesop_2836
Enzymes [BR:mop01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Mesop_2836
Secretion system [BR:mop02044]
 Type IV secretion system
  Trb secretion system protein
   Mesop_2836
SSDB
Motif
Pfam: T2SSE Zeta_toxin AAA_16 AAA_28 TrwB_AAD_bind ABC_ATPase AAA_30 DEAD MMR_HSR1 FtsK_SpoIIIE AAA_7 GTP_EFTU Mg_chelatase CbiA Septin AAA_19
Other DBs
NCBI-ProteinID: AEH87294
UniProt: F7Y4H4
Position
2942101..2943084
AA seq 327 aa
MANSHNDTEGRARSSRMLRTALGPAIARFLDDPAIVEVMLNPDGRIWVDRLSDGLADTGE
MLAPAAGERIVRLVAHHVGAEVHSRSPRVSAELPQTGERFEGLLPPVVAAPAFAIRKPAV
AVFTLEDYVAAGTMSAGQAAILRAAVAGRVNILVAGGTSTGKTTLTNALLAEVAKGMDRV
VIIEDTRELQCAAPNLVAMRTKDGVATLSDLVRSSLRLRPDRIPIGEVRGAEALDLLKAW
GTGHPGGIGTLHAGSGIGALRRLEQLIQEAVVTVPRALIADTIGLVAVLAGRGAARRLVE
LVTVEGLGRDGDYHIAEATPINTGESS
NT seq 984 nt   +upstreamnt  +downstreamnt
atggccaattcgcacaacgataccgaaggacgcgcgcgcagctcgcgtatgctgcgcacc
gcgctcggacccgccatcgcccggtttctcgacgaccccgccatcgtcgaggtaatgctc
aacccggacggccgcatctgggtcgaccggctctcggacggtttggccgacacgggggaa
atgctggcgcccgccgccggcgagcgcattgtgcgtctggtcgcccatcatgtcggcgcc
gaggtccattcccgttccccgcgcgtctcggccgagttgccgcaaaccggcgagcgtttc
gagggcttgttgccgcccgtcgttgccgcaccagccttcgcgatccgcaagcccgccgtc
gccgtgttcacgctcgaagactacgtcgcggcaggcaccatgtcggctggccaggccgcg
atattgcgggccgctgttgctggccgcgtgaacattctcgtcgccggcggcacgtcgacg
ggcaagacgacgctcaccaacgcgctgctcgccgaagtggcgaagggaatggatcgggtc
gtcatcatcgaggacactcgcgaattgcaatgcgccgcgcccaacctcgtcgcgatgcgc
accaaggatggtgtcgccacgctttccgacctggttcgatcctcgctgcgcttgcggccc
gatcgcattcccatcggcgaggtgcgcggcgccgaagcgttggaccttctgaaggcctgg
gggaccgggcatccgggcggcatcggcacccttcatgccggctccggtatcggcgccctg
cgccgccttgagcagcttatccaggaggctgtcgtcaccgtgccgcgtgcgctgatcgcc
gacacgatcggccttgtcgccgtgcttgccgggcgcggcgccgcgcgtcggcttgtcgag
ctggtcacggtcgagggtcttggccgcgacggcgactatcacattgctgaagccaccccg
atcaacacaggagaaagctcatga

DBGET integrated database retrieval system