KEGG   Methylorubrum populi: Mpop_3086
Entry
Mpop_3086         CDS       T00760                                 
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
mpo  Methylorubrum populi
Pathway
mpo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mpop_3086
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mpo02044]
    Mpop_3086
Enzymes [BR:mpo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Mpop_3086
Secretion system [BR:mpo02044]
 Type IV secretion system
  Trb secretion system protein
   Mpop_3086
SSDB
Motif
Pfam: T2SSE Zeta_toxin TrwB_AAD_bind AAA_16 ATPase AAA_19 DEAD MMR_HSR1 AAA_28 ABC_ATPase FtsK_SpoIIIE nSTAND3 AAA_25 P-loop_TraG MoCF_biosynth GTP_EFTU CbiA AAA_30 AAA_7 DUF815 AAA_22 TsaE Septin
Other DBs
NCBI-ProteinID: ACB81241
UniProt: B1ZGK7
Position
3310926..3311957
AA seq 343 aa
MAGSHHNPEGLARGARMLRTALGAAIARFLEDASVVEVMLNPDGRIWIDRLSEGLADTGE
MLSAADGERIVRLVAHHVGAEVHAGSPRVSAELPETGERFEGLLPPVVAAPAFAIRKPAV
AVFTLDDYVHAGIMSARQAEALRQGIIARDNILVAGGTSTGKTTLTNALLAEVAKTSDRV
VIIEDTRELQCAAPNLVAMRTQDGVASLSDLVRSSLRLRPDRIPIGEVRGAEALDLLKAW
GTGHPGGVGTIHAGSAIGALRRMEQLIQEAVVTVPRALIAETIDLVAVLSGRGSARRLSE
LVRVEGLGPDADYRVAPAVSSSSAGGDRCAGSLNPTSIEGEPL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggccggttcacatcacaatccagagggcttggcgcgcggcgcgcggatgctgcgcaca
gcgctcggcgccgccatcgcccggtttctggaagacgcctccgtcgtcgaggtcatgctg
aacccggacgggcgcatctggatcgaccgactctccgaagggctggccgatacgggcgag
atgctgtccgccgccgatggcgaacgcatcgtgcgtctggtcgcgcaccatgtcggcgcc
gaggtccatgccggtagtccgcgcgtctctgccgagctgcccgaaacgggcgagcggttc
gagggtctgctgccaccggtcgttgcagcgccggccttcgccatccgcaaacctgccgtc
gccgtctttaccctcgacgactacgtccacgcggggatcatgtcggcgcgacaggccgag
gcgctccgtcagggcatcatcgcccgggacaatatcctcgtcgccggcggcacctcgacc
ggcaagaccacactcaccaatgcgctgctcgcggaagtcgcgaagacgtccgatcgcgtc
gtcatcatcgaggacacccgcgagctacaatgcgcggcacccaatctcgtcgccatgcgg
acccaggacggtgtggcgtcgttgtcggatctcgtccgctcttcgctacgcctgcgcccc
gaccgcatcccgattggtgaggtccgtggcgccgaggccctcgacctcctgaaagcatgg
gggactggccatccaggcggcgtcggcacgatccacgctggcagcgccatcggcgcgttg
cggcgcatggaacagctcatccaggaagccgtcgttaccgttccgcgcgccctgatcgcc
gagacgatcgacctcgtggccgtcctttctggccgcggttccgcgcgccgcctctccgaa
ctcgtccgtgtcgagggcctcggccctgacgccgattaccgcgtcgcgcccgccgtcagc
tcttcgtctgccgggggcgaccgctgcgcgggctctctcaaccccaccagcatcgaagga
gaacccctgtga

DBGET integrated database retrieval system