KEGG   Methylibium petroleiphilum: Mpe_A2394
Entry
Mpe_A2394         CDS       T00470                                 
Name
(GenBank) conserved hypothetical protein
Organism
mpt  Methylibium petroleiphilum
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE ATPase_2 T2SSE AIG1 TrwB_AAD_bind AAA_16 DUF4913 AAA_10 AAA_7 DUF87 Oscp1
Other DBs
NCBI-ProteinID: ABM95349
UniProt: A2SIG0
Position
2557291..2560179
AA seq 962 aa
MAWSLPWSRKPDASPADAVDAADDAWARHVTALAVQGVAEPGSALGRGRRRPATQADHDA
LYGVAPSFADLLPWVEYLPDTKCMLLEDGQSVAAFFELAPVGTEGREMAWLWQARDALEN
ALQDSFDELDDNPWVVQLYAQDEADWDNYRRSLANYLQPRAQGSAFSDFYLRFFAHHLRA
IAKPGGLFEDTTVTRLPWRGQVRRVRMVVYRRTSAAQTSRRGQSPEQALTTICDRLAGGL
ANAGVKARRLGAADIHAWLLRWFNPNPTLLGATAEDRERFYALSRYPEEREEGEIELASG
TDFAQRLFFGQPRSDVPNGLWFFDGMPHRVIVMDRLRTPPVTGHLTGETRKGGDAMNALF
DQMPEDTVMCLTLVATPQDVLEAHLNHLARKAVGETLASEQTRQDVQQARGLIGSAHKLY
RGALAFYLRGRDLAQLDARGLQLVNVMLNAGLQPVREEDEVAPLNSYLRWLPCVFDPAAD
KRQWYTQLMFAQHAANLAPVWGRSQGTGHPGITFFNRGGGPITFDPLNRLDRQMNAHLFL
FGPTGSGKSATLNNILNQVTAIYRPRLFIVEAGNSFGLFGDFAARLGLTVHRVKLAPGAG
VSLAPFADAWRLVDTPSQVQTLDADALDEDQTDAGMAVEGDEQRDVLGELEITARLMITG
GEDKEEARMTRADRSLIRQCILDAAQHCVADRRTVLTRDVRDALRERARDATLPEMRRAR
LLEMADAMDMFCQDVDGEMFDRSGTPWPEADITIVDLATFAREGYNAQLSIAYISLINTV
NNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNLDDLPK
AAEPMLNMIEWWICLSMPPDEVEKIARFRELNASQKALMLSARKEAGKFSEGVILSKSME
VLFRAVPPSLYLAMAMTEPEEKAERFQLMQQHGISELDAAFRVAEKIDRARGIEPLTLDT
LA
NT seq 2889 nt   +upstreamnt  +downstreamnt
atggcctggtcgctgccgtggtcacgcaagcccgacgcatcgcctgctgacgccgtagat
gcggccgatgatgcctgggcacggcacgtaacggcgctggcggtacagggtgtcgccgag
ccgggcagcgcgctcggccggggccggcgcagaccggccacccaggccgaccacgatgcg
ctctatggcgtcgcgccgtcgttcgcggacttgctgccctgggtcgagtacctgcccgac
accaagtgcatgttgctggaagacggccagtcggtggcggccttcttcgagctggcgccg
gtcggcaccgagggccgcgagatggcctggctgtggcaggcgcgcgatgcgctggagaac
gccctgcaggattccttcgacgagttggacgacaacccctgggtggtgcagctctacgcc
caggacgaggccgactgggacaactatcggcgctccctggcgaactatctgcagccgcgt
gcacagggcagcgcgttcagcgacttctacctgcgcttcttcgcccatcacctgcgggcc
atcgccaagccgggtggcctgttcgaggacaccacggtgacgcgcctgccgtggcgcggc
caagtccggcgcgtgcgcatggtggtctaccgccgcacgtccgcggcccagacctcgcgg
cgcggccagtcgcccgagcaggcgctgaccacgatctgcgaccgcctcgccggcgggctg
gccaatgccggcgtgaaagcccggcgtctcggcgcggcggacatccatgcctggctcctg
cgttggttcaacccgaatccgaccttgctcggcgccactgccgaagatcgggaacgcttc
tatgcgctgagccgctacccggaagagcgggaggagggcgagatcgaactcgccagcggc
accgatttcgcgcagcgcctgttcttcggccagccccgctcggacgtgcccaacggcctg
tggttcttcgacggcatgccgcatcgggtgatcgtgatggatcgcctgcgcacgccgccc
gtgacgggccatctgacgggcgagacgcgcaaaggcggcgatgccatgaacgcgctgttc
gaccagatgcccgaggacacggtgatgtgcctgacgctggtcgccacaccccaggacgtg
ctggaggcgcacctcaaccacctcgccaggaaggccgtcggcgagaccctggcctcggag
cagacccggcaggacgtgcagcaggcgcgcgggctgatcggcagcgcgcacaagctctac
cgtggcgcgctggcgttctacctgcgcggccgcgacctggcccagctcgatgcgcgcggc
ctgcagctcgtcaacgtgatgctcaacgccggcctgcaaccggtacgcgaagaggacgag
gtggcgccgctgaacagctatctacgctggctgccgtgcgtgttcgatccggcggccgac
aagcgccagtggtacacccagctcatgttcgcgcaacatgcggcgaacctggcgccggtc
tggggccgcagtcagggcacggggcatccgggcatcacgttcttcaaccgcggcggcggc
ccgatcaccttcgatccgttgaaccgcctcgaccggcagatgaacgcgcatctattcctg
ttcggccccacgggttcgggcaagagcgcgacgctcaacaacatcctgaaccaggtgacg
gcgatctaccggccgcgcctgttcatcgtcgaggcgggcaacagcttcggcctgttcggc
gacttcgcggcacggctgggcctcaccgtgcatcgggtgaagctcgcgccgggcgcgggc
gtcagtctggctccgttcgccgacgcctggcgcctggtcgatacgccgagccaggtacag
acgctggacgccgatgcgctcgacgaagaccagaccgatgccggcatggccgtggaaggc
gacgagcagcgcgacgtgctcggcgagctggagatcactgcacggctgatgattaccggc
ggcgaggacaaggaagaagcgcgcatgacgcgcgccgaccgcagcctgatccgccagtgc
attctcgatgcggcccagcattgcgtggcggacagacgcacggtgctcacgcgcgatgtg
cgcgacgcgctgcgcgagcgcgcccgcgacgccacgctgccggagatgcggcgcgcacgg
ctgctggagatggccgacgccatggatatgttctgccaggacgtggacggcgagatgttc
gaccggtccggcacgccgtggcccgaggcggacatcaccatcgtggacctggccaccttc
gcgcgcgagggctacaacgcccaactctcgattgcctacatctcgctcatcaacaccgtc
aacaacatcgccgagcgcgaccagttcctgggccgtccgatcatcaacgtgacggacgaa
ggccacatcatcacgaagaacccgctgctcgcgccctacgtggtcaagatcaccaagatg
tggcgcaagctcggcgcctggttctggctcgccacgcagaacctcgacgacttgccgaag
gcggccgagcccatgctcaacatgatcgagtggtggatctgcctgtcgatgccacccgat
gaagtggagaagatcgcgcgcttccgcgaactcaacgcttcgcagaaggcgctgatgctc
tcggcgcgcaaggaggccggcaagttcagcgagggcgtcatcctgtccaagtcgatggag
gtgctgttccgcgccgtgccgcccagcctctacctggcgatggcgatgaccgagcccgag
gagaaggccgaacgcttccagttgatgcagcagcacggcatcagcgaactggatgccgcc
ttccgcgtggccgagaagatcgaccgcgcgcggggcatcgaacctctgacgctggacacg
ctggcctga

DBGET integrated database retrieval system