KEGG   Numida meleagris (helmeted guineafowl): 110394477
Entry
110394477         CDS       T06015                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
nmel  Numida meleagris (helmeted guineafowl)
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nmel03000]
    110394477 (AHRR)
Transcription factors [BR:nmel03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110394477 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 Herpes_U5 PAS_4
Other DBs
NCBI-GeneID: 110394477
NCBI-ProteinID: XP_021244031
Position
2
AA seq 758 aa
MIPPGECLYAGRKRRKPIQKQRPAAGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNVSNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMLS
GQQLQTETGEEYILSKLFKAQENDSTTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGAVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAVNTNS
SSKGNPGLCEAEELYGRNSHHEGAAFTNVLQITENQFKAKNNGENGISLVKVQTNEDHWV
WVQANTQLLYRSGCSEYVVAQQQMLKEEDEQLKIPNSFASLKGNLEGLSYNSAIETLGQL
KHLNWTAVKNEQDNVKVKFEPHTNGECFVQEESLSSNTPVLGVQNNCTTNSSWTYRNSSS
CSVNQRMNACSNRRAGSFYNRDQNFLNLASTCPSHWGSAENCQSYSGLQQRAVENYATDH
LKLQRSLISSESLYDAAFPLDMPIKTEYDSDSENIADNYPVPQNRAWLDENGAMRKQVFS
YPNRVHLKTEPDLCQQASPCQKPRHCLYTPHNWQCIVANHPSNLNLNRSCKGLRNREVAP
FCPQNSSTCLESLSELPHTESYGQFYSSASGEEKEQSNEVFKMPYEFKNPCLVQAIKREP
LDSPPLSNSGQNRAHVSFPENTIAGPVPHKATECTFLQ
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctctatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgcagctggaaatgaaaaatcaaatccttcaaagaggcacagggaccgcctg
aatgcagaactagaccacctggccagcctcctgcctttcccacccgacataatatccaag
ctggacaagctgtctgtgctgcgcctcagtgtcagctacctacgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaggttggtcagacaataaaagaagacaat
gtatctaacaagactgctgtccaagaaggcggacttctactagagtcgctgaatggtttt
gcattggtggtgagtgcagatggaatgatattttatgcgtcatcaacgattgtggactac
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgttgat
gatcgccaggatttctgtagacagctgcactgggccatgaatcctcctcagatgttgtct
ggacagcaattacagacagaaacaggagaagaatatattctcagtaagttgtttaaagca
caagagaatgacagcacgacaacagattattcttccttcttaactcgttgtttcatctgt
cgagttcgctgcttgttggacagtacttctggcttcctcacaatgcagtttcaaggcaaa
ctgaagtttctttttggacaaaggaagaagtcctcatcgggagcagtattaccgcctcag
ctgtccttattctgcatagtggtaccacttcttctcccttctgtgacagagatgaagatg
aaaagcctacttgtgaaagcaaaacacaaagctgatgatgcagcagtgaatacaaactcc
agttccaaaggcaatccgggtctgtgtgaagcagaagaattatatggaagaaatagtcat
catgaaggtgcagctttcactaatgtattacagattactgaaaaccaattcaaagcgaag
aataatggagaaaatggcatttctctagtcaaagtacaaacaaatgaagatcactgggtc
tgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgttgttgcc
caacagcaaatgctgaaggaagaagatgaacaactgaagataccaaacagttttgccagt
ttgaaaggaaacctggagggactttcctacaacagtgccattgaaaccctgggccaattg
aagcatctcaactggacagcagtaaaaaatgagcaagataatgtaaaagtgaagtttgag
cctcatacgaatggtgagtgtttcgtgcaggaggaatctctcagttctaatacaccagtt
ttaggcgttcaaaacaactgcaccacaaacagtagctggacttacagaaactcaagctct
tgttctgtaaatcagcgaatgaatgcatgttcaaacagaagagctggatcattctacaac
agagaccaaaatttcttaaatttagcatcaacttgtccttcccactggggtagtgcagaa
aattgccagtcttactcaggcttacagcagcgtgctgtggagaactatgctacagaccac
ctgaaactgcagagatcattaatatcctcggagtctctctatgatgcagcatttcctttg
gatatgcctatcaaaacagaatatgattctgattctgaaaacattgctgataactaccca
gtgccacaaaaccgagcctggctggatgagaacggcgccatgaggaagcaggtgttcagc
tatcccaatagggtgcaccttaaaacagaaccggacctctgtcagcaagcttcaccttgc
cagaagccaaggcactgcctttacacaccacataactggcaatgcattgtagcaaatcat
cccagcaacctcaatctgaacagatcttgcaagggtttgcgtaacagagaggtggccccg
ttttgtccccagaactcctccacctgcttggaaagcctgtccgagctgccgcacaccgag
agctacggccagttctacagctctgcatcaggggaggagaaggagcagagtaacgaggtg
tttaaaatgccgtatgaatttaaaaacccttgcttggttcaagcaatcaagcgtgagccc
ctggattccccaccgttgtccaacagtgggcagaacagagcacacgtgagcttccctgaa
aatacaatagcaggtcctgtgcctcataaagccactgaatgtacattcttacaatag

DBGET integrated database retrieval system