KEGG   Nitrosococcus oceani: Noc_0648
Entry
Noc_0648          CDS       T00281                                 

Definition
(GenBank) conserved hypothetical protein
Organism
noc  Nitrosococcus oceani
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE DUF87 AAA_10 Pox_A32 AAA_16 TrwB_AAD_bind T2SSE AAA_22 AAA_29 ABC_tran ATPase_2 AAA_7 Adeno_IVa2
Other DBs
NCBI-ProteinID: ABA57167
UniProt: Q3JDC9
Position
694894..697620
AA seq 908 aa
MTNSKFPDTSDASPLTSDSIKQHYHRPPSFTDLLPWMEYLPESKTFLLEDGVSLGALFEV
LPVGCEARTPAFMTQLRDAIQIAINEAIPERDDAPWVLQIYVQDEPKLTQLNALLASYPS
PTVRASDYSQHYQSVMSQHLQAISRPGGLFDDTTVTGSRWQGQQRRIRVVLYRRLISNGK
SPAAIEVEEAINDVATKWIASLASAGIKVQRANGQAFYQWLLSWFNPNPPLADGNPEALL
QLAPYPGDENLPFGHDFAEQLTLSMPRSDEATASWVFDNMPHTVVTIQSLRRAPDIGHFT
AERQAGDQVFSLFDRLPEHTIMAITLTLKPQDTTRNHIAQIKRASVGDSAEASITREDAE
HVEREMAQGNKLYPVSMAFYVRGDNQKSLRNNLNRLHALLLPNGLQPIAQEADLLSLDSY
IRNLPMAYDADLDKSRRRSRLIFSRHIANLLPFYGRSRGTGHPGLVFYNRGAEPLVFDPL
HRDDRKKNAHMLILGPTGAGKSALLVYLLQQMMARHRPRIFIIEAGASFSLLGQHFAHHG
LSVNQITLNPNVDVSLPPFTDALRLLDRRHAFNPLSVDESTMEETLDEDDEIEEEGGGRD
ILGEMEIAARIMITGGDEREDARLTRADRLLIRNAIFLAAKTVKETSRTQVITQDVVNAF
QTIATNAELPEHRRNRALEMGDGMALFCSGLAGHFFNRPGQSWPAVDVTILEMGMLAREG
YEDQLTVAYLSMMSHINDLVERHQHDDRPTLVVTDEGHIITTNPLLARYVVKITKMWRKL
GAWFWIATQNLEDFPDASRKMLNMMEWWLCLVMPKEEVEQIARFKDLNDEQRNLLLSARK
EPGKYVEGVVLADKVEALFRNVPPALSLALAMTEKHEKAERAAIMREKNCSELEAVYEIA
QRIEQTRA
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgacgaattcaaaattccccgatacttcggacgcttcgcccttaacttccgattcgata
aaacagcactatcatcgccctccgtcgtttaccgacctgttgccctggatggaatacctc
cccgagagcaaaacctttctgttggaggacggcgtcagtctgggagccttgttcgaggtg
ctgccggtcggttgcgaagcgcgcacgccagcgtttatgacacagttgcgcgatgctatt
caaatcgctatcaacgaggccattcccgagcgcgatgatgcgccctgggtgttacagatc
tatgtgcaagatgagcccaagctaacccaattgaatgcgttgctggccagttatccgtcg
ccgacggttcgtgcatcggattattcccagcattaccagtcggtgatgtcgcaacacttg
caggcgatttctcgaccgggtgggttgtttgacgataccaccgtcaccggttcgcgttgg
caggggcagcaacgtcggatccgtgtagtgctctaccgtcgtttgataagtaatggcaaa
tccccagccgctatagaggtggaggaggcgatcaacgatgtggcgaccaaatggatcgcc
tcattggcctctgccgggataaaggtccagcgtgccaatggtcaggcgttttatcagtgg
ttgctgagctggttcaatcccaatccaccgttagcagacggtaatccggaagcacttctg
cagctggcgccatatccgggcgatgaaaacttaccgttcggccatgactttgctgagcaa
ctgaccctctcgatgccacgctccgacgaggcaacagcgagttgggttttcgataatatg
ccgcacactgtagtgaccatccaaagcttacggcgggcaccggacattgggcacttcacg
gcggagcgccaggccggggatcaggtgttttcgctatttgatcgtctgcccgagcacact
atcatggcgatcacactcactctcaagccgcaggacaccacccgtaatcacatcgcccag
atcaaacgcgcatcggtgggtgattccgctgaagcgtcgattactcgggaagatgcggaa
cacgtggagcgggagatggcacagggcaacaagctgtatcccgtgagcatggccttctat
gtgcggggcgataatcaaaagtcgctgcgtaacaatttgaatcgactccatgcgctgctc
ttacccaatggcctgcagcccattgcccaggaagcggacctactgtcgctcgacagctat
atccgcaacttgcccatggcctatgacgcagacctggacaaatcccgtcgtcgctcgcgg
ctgatcttctctcgccacattgccaatttactgccgttctacggtcgttcccgtgggacc
ggtcatccgggcctggtattctacaaccgaggtgccgaacctttggtcttcgacccgctg
catcgggatgaccgtaagaaaaatgcccacatgctgatcctggggccgacgggtgcgggg
aagtcggcgctactggtgtatctgctgcagcagatgatggcacggcaccggccacgtatt
tttatcatcgaggccggtgcttcgttttcgctgttgggacagcattttgcgcaccacggt
ctgtcagtaaaccagataaccctgaaccccaatgtcgatgtcagcctgccgccctttacc
gatgcgcttcgactgctggatcggcgccatgcgtttaatccgcttagtgtcgatgaatcc
acaatggaggagacgttagacgaagatgatgagatcgaggaggaagggggcggtcgcgat
attctcggtgagatggagattgctgcacgcatcatgattaccggtggtgatgaacgcgaa
gacgcgcgattgacccgggccgatcgactgctgatccgcaatgccatattccttgccgca
aaaaccgtgaaagagaccagccgaacccaggtaattacccaggatgtggtcaacgccttt
cagaccatcgccaccaacgcggagttacccgaacaccggcgtaatcgtgcactcgagatg
ggcgatggtatggcgctgttctgctcgggcctggctggccacttcttcaaccgaccggga
cagtcctggcctgcggtcgatgtcactatcctcgaaatgggcatgctggcaagagagggc
tacgaggatcagctcactgtcgcctacctgtcgatgatgagtcacatcaacgacctggtg
gaacgccaccagcacgacgatcggcccacactggtggtcacggacgaaggccacattatt
accaccaatcccttgctggcccgttacgtggtcaagatcaccaagatgtggcgcaagctc
ggtgcctggttttggatcgccacccagaatcttgaagatttcccggacgccagccgcaag
atgctcaacatgatggagtggtggctgtgcctggtcatgccgaaagaggaggtggaacaa
atcgcccgcttcaaggacctgaatgacgaacaacgtaacctgctgctgtctgcccgcaag
gagccgggaaaatacgtggagggtgttgtgctggccgacaaagtcgaagccctgtttcgc
aatgttccaccagctttgtcactcgccctggcgatgaccgaaaagcacgagaaagcagag
cgggctgccattatgcgtgagaaaaactgctcggagctggaggccgtttatgaaatcgcc
cagcgtatcgaacagactcgcgcgtag

DBGET integrated database retrieval system