KEGG   Nasonia vitripennis (jewel wasp): 100118406
Entry
100118406         CDS       T01081                                 
Name
(RefSeq) ras-related protein Rab-23
  KO
K06234  Ras-related protein Rab-23
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100118406
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:nvi04031]
    100118406
Membrane trafficking [BR:nvi04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100118406
GTP-binding proteins [BR:nvi04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab23
    100118406
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase FeoB_N GTP_EFTU PduV-EutP Gtr1_RagA Septin
Other DBs
NCBI-GeneID: 100118406
NCBI-ProteinID: XP_001602379
NASONIABASE: NV16616
UniProt: A0A7M7LJ55
Position
3
AA seq 238 aa
MREEELEISLKVVIVGNGAVGKSSMIQRFCKGTYTRDYKKTIGVDFLEREIEVDGEDVRL
MLWDTAGQEEFDAITAAYYRGAHACVLAFSATDRDSFDAIPSWKLKVENECGEIPTVLVQ
NKMDLIDQCVIDPDEAERLGRALGCKLLRTSVKEDVGVMSVFRHLASRCLYEMRRYEEEE
DFRIYSCGPRSPSVISAFSPNGSTGGRNLGNGTIVLRATGKMRHHKKKNFVKNACRLL
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcgggaggaagagctcgagatatcactcaaggtggtgatagtcggcaatggtgcggtg
ggcaaatcctccatgatccagaggttctgcaagggcacctacacccgagactacaagaag
accattggggttgattttctcgagcgggagatcgaagtcgacggcgaggacgtgcgactg
atgctctgggacaccgccggacaggaggagttcgacgccatcaccgcggcttactatcgc
ggcgcccacgcttgcgtcctggccttctcggcgaccgacagagattccttcgatgccatt
ccctcctggaagctcaaggtggagaacgaatgcggggaaatcccaacagttttagtgcag
aacaagatggatttgatcgaccaatgcgtcattgatccagatgaagcggaaaggctcggt
agggcgttgggctgcaagttgctgcgcacctcagtcaaagaggacgtcggtgttatgagc
gtcttccgacacctcgcctcgcgctgtctctacgagatgcgcagatacgaagaggaagag
gacttcaggatctactcctgtggcccgagatcgccatcggtcattagtgccttcagtccg
aacggatcgacgggtggcaggaaccttggaaacggcacaatcgtcctccgggccactggc
aaaatgaggcatcacaaaaagaagaatttcgtaaaaaacgcctgtcgactgttgtag

DBGET integrated database retrieval system