KEGG   Afipia carboxidovorans OM5 (Mississippi): OCAR_4192
Entry
OCAR_4192         CDS       T00783                                 
Symbol
trbB
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
oca  Afipia carboxidovorans OM5 (Mississippi)
Pathway
oca02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:oca00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OCAR_4192 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:oca02044]
    OCAR_4192 (trbB)
Enzymes [BR:oca01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     OCAR_4192 (trbB)
Secretion system [BR:oca02044]
 Type IV secretion system
  Trb secretion system protein
   OCAR_4192 (trbB)
SSDB
Motif
Pfam: T2SSE Zeta_toxin TrwB_AAD_bind AAA_16 AAA_28 ABC_ATPase DEAD FtsK_SpoIIIE nSTAND3 MMR_HSR1 AAA_22 AAA_19 AAA_25 AAA_7 GTP_EFTU CbiA P-loop_TraG Septin
Other DBs
NCBI-ProteinID: ACI91341
Position
complement(197716..198696)
AA seq 326 aa
MAAIHDNTEGRTRSSRMLRTALGAAITRFLDDPSIIEVMLNPDGRVWVDRLSEGLADTGE
TLSPADGERIVRLVAHHVGVEVHPRAPRVSAELPETGERFEGLLPPVVAAPAFAIRKPAV
AVFALEDYVAAGIMTATQAVTLREAVISRANILVAGGTSTGKTTLTNALLAEVAKGADRV
VIIEDTRELQCAAPNLVAMRTKDGVATLSDLVRSSLRLRPDRIPIGEVRGSEALDLLKAW
GTGHPGGIGTIHAGTGIGALRRLEQLIQEAVVTVPRALIAETIDLVAVLSGRGSARRLAE
LARVEGLGPDGDYRITPATSTTGDNT
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcggcgatacatgacaatacagaagggcgcacacgcagttcgcgcatgctgcgtaca
gccctcggcgccgccatcacgcggttcctggatgacccatccatcatcgaagtgatgcta
aatccggacggccgcgtctgggttgatcgcctctccgaaggtcttgccgacaccggcgaa
acgctctctccagccgatggcgaacgtatcgtccgcctcgtcgcgcaccatgtcggcgtc
gaagtccatccccgcgctccgcgcgtctcggccgagctgccggaaacaggtgagcggttc
gagggcctgttgccccccgtcgtggctgcgccggccttcgccatccgcaagccggccgtc
gcggtgttcgccctcgaagactacgtggccgccggcatcatgaccgccacccaggctgtg
acgctgcgcgaggccgtcatatcccgcgccaacatcctcgtcgcgggcggcaccagcact
ggcaagaccacgctgaccaacgcgctgctcgccgaggtggccaagggcgcggatcgcgtc
gtcatcatcgaggacacgcgcgagctgcaatgcgccgcgcccaaccttgtcgcgatgcgg
acgaaggatggcgtcgccacgctttccgatctggtccgatccagcctgcgcctgcgcccc
gaccgcatcccgatcggcgaggtgcgcgggtccgaagccctcgatctcctcaaggcctgg
ggcaccggccaccccgggggcatcggcaccatccatgccggcacgggcatcggcgcgctg
cgccgcctcgagcagctcatccaggaagccgtcgtcaccgtcccacgcgccctgatcgcc
gagacgatcgaccttgtcgccgtcctctccggccgcggttccgcgcgccggctcgcagaa
ctcgcccgcgtcgaaggcctcggccccgacggcgactaccgcatcacccctgccacctca
accacaggagacaacacatga

DBGET integrated database retrieval system