KEGG   Orientia tsutsugamushi Ikeda: OTT_0401
Entry
OTT_0401          CDS       T00705                                 
Name
(GenBank) putative conjugative transfer protein TraD
Organism
ott  Orientia tsutsugamushi Ikeda
SSDB
Motif
Pfam: TrwB_AAD_bind TraD_N TraG-D_C T4SS-DNA_transf T2SSE AAA_22 DUF87 AAA_16 AAA_18 cobW AAA_10 FtsK_SpoIIIE nSTAND3 PIF1 AAA_7 ResIII AAA_19 Sigma54_activat ATPase_2 HerA_C
Other DBs
NCBI-ProteinID: BAG39859
UniProt: B3CQV2
Position
complement(420842..422596)
AA seq 584 aa
MNFQNQGNFTRGSQLFAHKLRMFGQGSTNVFIIGLGLSIFWIICRLYQKVFLSSLYYFVI
ERYVQLKLAIGEHFYDIDQIGIKFYSLRFKKWMHLNAQDFLHEFYTSQHGFKIQQLLEFL
INSALLEGLIVFAIGVIISIVFFTAQGKNTIIKAKIRGADFVECKCLSKMLKSAKKASKI
CFGGLPLVKNSERLHILITGTTGTGKTNMLNELLPQIRLHKDRAIIVDTTGAFTDRFFDS
KCDKLLNPLEKNSEQWLPWNDCFEAANFHDIASSFSNYTPKLDDFFAKNAELVLSEALKL
YQDDKDIIKLIHTIIYSDNRQFAKAFRNTAVSGIISESALETSAGIQSTLGKNITSLQYL
KPGGSFSIKEWFSNSNETGWLFITATPSQRATLCPLISAWISIAIKALMCRNPNHDNKNM
WFILDELPALQKVSSLPVALAESRKYGGCFVAVLQNIHQLEAIYGAAECASMLDLFNSKF
IFRVSDQVTAYKSALTLGEQEIIETQENLSYGSNTMRDGVNMNNVERKKILVMPSEIMNL
PDLTCYVKLAGNFPITKLTMQLQNLNTAFVCEYKLLKKLKLVEY
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgaattttcagaatcaaggaaatttcaccagaggatcgcagttatttgcccataagtta
agaatgtttgggcaaggtagtaccaacgtttttataattggattaggattatcgatattc
tggattatatgtcgattatatcaaaaagtttttctgagcagcttgtattattttgtaatt
gaaagatatgtgcagcttaagctagcaattggtgagcacttttatgatatcgatcaaata
ggcattaagttttatagtttaaggtttaaaaaatggatgcacctcaatgctcaagacttt
ttgcatgaattttatacaagccaacatggatttaaaatacagcaattattggaattctta
attaattcagcattgttagaaggattaattgtttttgctattggtgtgataatctcaatt
gttttctttacagctcaaggcaaaaacacgattattaaggccaaaattagaggtgctgat
tttgtagagtgcaaatgcctatctaaaatgctaaaaagcgctaaaaaggcctcgaaaatc
tgttttggaggcttgccattagtaaagaatagtgaaagattacatattctgattactgga
acaacaggtactggtaaaactaatatgcttaacgaactgctaccacaaattcgattacat
aaagatcgagcaataattgtagatacaactggagcttttactgatagattttttgattct
aaatgtgataagctgcttaatcctttggaaaaaaatagtgagcaatggttgccttggaat
gattgttttgaagcagctaattttcatgatatagctagtagttttagtaattatactcct
aaacttgatgacttttttgctaaaaatgctgaattagtcttatctgaagcattgaagcta
tatcaggatgataaagatatcataaaactaattcatacaatcatttactctgataataga
caatttgcaaaagcttttagaaacacagctgtatcaggtattataagcgaaagtgcgctt
gaaacttctgcaggaattcagtctactcttggaaagaatattacttcgctacaatattta
aagcctggaggtagttttagcatcaaggaatggtttagtaattcgaatgaaactggctgg
ctatttatcacagctaccccaagtcaaagagctactttatgcccacttatttcagcctgg
ataagcatagctatcaaggctttgatgtgtagaaatcctaatcatgataacaaaaacatg
tggtttatacttgatgaattgccagctctacaaaaagtttcatctttaccagttgcttta
gctgaaagtagaaagtatggaggctgctttgttgctgtattgcagaacattcatcaatta
gaagcaatatatggggctgctgaatgtgcttctatgctggatttgtttaatagtaaattt
atttttcgagttagtgatcaggttacagcttataagtcagcattaacactaggtgagcaa
gaaattattgaaactcaagagaacttgtcatatggatcaaatactatgcgagatggggta
aatatgaataatgttgagcgtaaaaagattttagttatgccatctgaaattatgaaccta
ccagacttaacttgttatgtaaaacttgctggtaactttcctatcacaaaactaactatg
cagctacaaaacttaaatacagcttttgtttgtgaatataaattgctcaaaaaacttaag
ttagtagagtattaa

DBGET integrated database retrieval system