KEGG   Pseudomonas aeruginosa LESB58: PLES_26531
Entry
PLES_26531        CDS       T00818                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE TrwB_AAD_bind AAA_10 T2SSE ATPase_2 AAA_7 AAA_16 DUF87 AIG1
Other DBs
NCBI-ProteinID: CAW27378
Position
complement(2849315..2852200)
AA seq 961 aa
MRWKLPWPKLAGAGSSSPASDEQPDSWQRHVEALRQAGIPEPGSAVHGRKPATVADEQAL
YDVAPSFVELLPWVEFLPGSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENA
LQDSFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARGSAFTEFYLRFFGHHLRAV
AKPGGLFEDTVVTRLRWRGQTRRVRMVIYRRATGQASRRGQTPEQMLNIVCDRLCGGLAN
AGIQARRMVAADVHDWLLRWFNPRPAMLGPSAEDRERFYALARYPDSTEESEAGEIELAS
GRDFSQRLFFGQPRSDVEHGTWYFDGMPHRVLITDRLRMPPGTGHLTGETRKGDAINTLF
DQMPEDTLLCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLY
RGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQD
RRKWYTQLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLSRLDRQMNAHLFL
FGPTGSGKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFARMLGLTVNRVKLAPGSG
ISLAPFADARRLIETPSDVQTLDADALDEDPPPDASAMEADEQRDVLGELEITARLMITG
GEDKEEARMTRADRSLIRQCILDAAEHCVADKRTVLTRDVRNALRARGQDPTLPEMRRVR
LLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLISTV
NNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPR
AAEPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSME
VLFRAVPPSLYLALAQTEPEEKAERYQLMQQYGCTELEAAFKVAEKIDQARGIESPALEL
S
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgcggtggaaactcccatggccgaagctggccggcgccggctccagtagcccggctagc
gatgagcagccggacagctggcagcgccacgtcgaggccttgcgccaggccggcatcccc
gaacccggttcggcagtccacggccgcaagccagcgaccgtggccgacgagcaggcgctg
tacgacgttgcgccgtccttcgtggaactgctgccctgggtggagttcttgcccgggtcg
aaatcgatgctcctggaggatggccaatcggtggcggcgttctacgaactggtgccgctg
ggcaccgaaggccgggaacccggctggctcgcgcatgcccgcgacgccctggaaaacgcg
cttcaggacagtttcgatgaactggacgagaacccgtgggtgctccagctctatgcccag
gacgaaccgagcttcgaccagtacatgcagaccttgcgcgattacgtgcagccacgtgcg
cgcggctcggcgttcaccgagttctacttgcgcttcttcggccaccacctgcgcgctgtg
gccaagcccggcggcctgttcgaggacacggtggtcacgcggctgcgctggcgcggccag
acgcggcgggtgcgcatggtgatctatcgccgtgcaactgggcaggcaagccgccgcggc
cagacgcccgagcagatgctgaacatcgtctgcgaccgcctgtgcggcggcctggcgaac
gccggcatccaggcacggcgcatggtcgcagccgacgtccacgactggctgctgcggtgg
ttcaatccgcgcccggcgatgcttggaccgagtgcagaggaccgggagcgcttctacgcg
ctggcgcgctaccccgacagcaccgaagaaagcgaggccggcgaaatcgagctggcgagc
gggcgggatttcagccagcggctgttcttcggccagccacgctccgacgtggagcacggc
acctggtatttcgacggcatgccgcaccgcgtgctgatcaccgaccggctgcgcatgccg
cccggcaccggacacctgaccggcgagacccgcaaaggggatgccatcaacacgctgttc
gaccagatgccggaagacaccttgctgtgtctcacgatggtcgccacgccgcaggatgtc
ctggaagcggatctcaaccacctggcgaagaaggccgtgggcgagacgctggcgtcggag
cagacgttgaaggacgtgcaggaagcccgctccctcatcggcagcgcacacaagctctac
cgggggacgctggcattctacctgcgcggacgcgacgaagcggaactggaccggcgcggc
ctggacctggcgaacgtgatgctcaatgctggcttgcagccggtgcgcgaggacgacgag
gtggcgccgctcaacagctacttgcggtggctgccatgctgctacaaccccggccaggat
cggcgcaagtggtacacccaactgatgttcgctcagcacgcggcgaacctgtcgccggtg
tggggccgcgctcaaggtacggggcacccgggcatcacgatgttcaaccgcggtggcggg
ccgatcaccttcgacccgctcagccgcctggatcggcagatgaacgcccatctgttcctg
ttcggccccaccggctccggcaagagcgccacgctcaacaacctcttgaatcaggtcacg
gccatctaccgaccgcggctgttcatcgtggaggctggcaacagcttcggcctgttcagc
gacttcgcacgcatgctcgggctgacggtaaaccgggtcaagctggccccaggttcgggc
atcagcctcgcgccattcgcagacgcgcgtcggctgatcgagacgcccagcgacgtgcag
acgctcgacgccgacgcgctggatgaagacccgccaccagatgcctcggccatggaggcg
gacgagcagcgcgacgtgctcggcgaactggagatcacggcgcggctgatgatcacgggc
ggagaggacaaggaggaagcccggatgacgcgggctgaccgctcgctgatccgtcagtgc
atcctcgacgccgccgagcactgcgtggccgacaaacgcacggtgcttacgcgcgacgtg
cgcaacgcgttgcgcgcccgcggccaggacccgacgctgcccgaaatgcgccgcgtgcgg
ctgctggagatggcggatgcgatggacatgttctgtcaaggcacggacggcgaaatgttc
gaccgcgacggcacgccgtggcccgaagccgacatcaccttggttgacctcgcgacatac
gcccgcgagggctacaacgcgcagctctccatcgcttacatcagcctgatcagcacggtg
aacaacatcgccgagcgcgaccaatacctgggacgcccgatcatcaacgtcaccgacgaa
ggccacatcatcacgaagaacccgctgctcgcgccctacgtcgtgaaaattacaaagatg
tggaggaaattgggggcctggttctggctcgcgacgcagaacatcgacgacctgccgcgc
gccgcggagcccatgctcaacatgatcgagtggtggatctgtctcagcatgccgcccgat
gaagttgagaagatcgcgcggttccgcgaactctcgcccgcgcagaaggcgctgatgctt
tcggcgcgcaaggaagcggggaaattcaccgaaggcgtcatcctctccaagagcatggaa
gtgctgttccgcgccgtgccgccgtccctgtacctcgccctcgcgcagacagaacccgag
gagaaggccgaacgctaccagctcatgcagcagtacggctgcaccgaactggaagcggct
ttcaaggtggccgagaagatcgaccaggcccgcggcatcgagtcgccggccctggaactg
tcgtaa

DBGET integrated database retrieval system