KEGG   Parvularcula bermudensis: PB2503_00692
Entry
PB2503_00692      CDS       T01298                                 
Name
(GenBank) TraC
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
pbr  Parvularcula bermudensis
Brite
KEGG Orthology (KO) [BR:pbr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pbr02044]
    PB2503_00692
Secretion system [BR:pbr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PB2503_00692
SSDB
Motif
Pfam: TraC_F_IV DUF5934 P-loop_TraG AAA_10 TrwB_AAD_bind AAA_22 ABC_tran DUF87 AAA_16 Mg_chelatase MeaB MobB AAA_28 FtsK_SpoIIIE AAA_29 NACHT ATPase AAA_30 AAA_7 EutA
Other DBs
NCBI-ProteinID: ADM08219
UniProt: E0TB10
Position
complement(39435..42008)
AA seq 857 aa
MTTDPLGLINRVGAALTGEGSLFDGVRRETSLDRLSEMLPYRLWDEEKALYLNAASTGWI
LEVVPFLGADETVVSVLAEMFSDGIPDNAYLQILNWASPRIGPVLDSWATARGGEAGVFK
TLALHRVDHLRRGAFRSLSAHAPFLARQFRVFVALGVEGDASPEVRHQLEGLRSNVAQAL
KSLGVASRPVAPDGLIRFLDEVLNPQFAVTRASAGYDPAELLDRQIVRPDTSLRVEADRL
LFETIAPADRSPFEAPGTTQLEDYRTGRFDVRAFSARKFPERFDQGGMALAIGHPLNDQL
RLPCPVLSCLAIAFGSKESSNDLAAAKFGRAEQQAATNMVRFLPELKDKADDWKWVRERV
RDGARLVRAGSFLIMVAPEGEAEAAERAVRSLYRGMGWELAKDRFVATQTLGACLPLTLA
DGLGADLQKLRRLRFMVTDTCVQIAPLQGEYLGMSTPDLMLLGRRGQPFFWSPFGNQGAG
NHNVAIIGSSGSGKSVLMQELVTGLRGAGTNVTVIDDGESFKHMCEALGGRHVKFTLEAD
VCLNPFSLLDERKAKEDGDYATESLTLVRAMIEQMAKGEERATAEERGLIDSAVAEVWKA
RGILAGIDDVAAALKEQGAEGVKLANALRPYTTAGLYGPFFNGEASLVIDNPLAVFEMKD
LEAKPELRAVVMLALMFLINQRMMADRREKMALVIDEAWALLGRGAAGEFIAGFARRCRK
YGGAIITGTQGIDDYYRTEGAKAAFENSDWCIVLKLKPEAIALVLKSERLSIDAHTADII
RSLSVSAGEYSEMLIMGPHGRHVGRLVLDPFSATLFSSDARTFAEIEALEAQGLTVAEAV
ERVAFRHQDKEVRHAAE
NT seq 2574 nt   +upstreamnt  +downstreamnt
gtgacgactgatccgctcggtctcatcaatcgcgtcggtgcggcgctgacgggcgaaggc
tcgctcttcgatggcgtccgccgcgagaccagcctcgaccggctctcggaaatgctgccc
taccggctctgggacgaagaaaaagcgctctacctcaatgccgcgtccacgggctggatc
ctggaggtcgttccattcttaggcgccgacgagacggtggtctcggtgctggccgagatg
ttctccgacggcattccggacaatgcctatcttcagatcctgaactgggcgagcccgcgg
atcggacctgtcctcgatagctgggcgacagcaaggggcggcgaggcgggcgtcttcaag
acgctggccctccaccgggtcgatcatctgcgccgcggcgccttccgctccttgtccgcc
cacgcccccttcctcgcacggcagttccgggtgttcgtcgccttgggcgtggagggcgat
gcgtcaccggaggtgcgccaccagctcgaggggcttaggagcaatgtcgcccaggccctc
aaatccttgggcgtcgcatcacggcctgtcgcaccggacggtctgatccggtttctcgac
gaggtcctcaacccgcaattcgcggtgacgcgggcaagcgctggctacgatccggccgag
ctcctcgaccggcagatcgtcaggcccgacacgagcctccgggtggaggccgaccgcctc
ctcttcgagaccatcgcgccggccgaccggtcccccttcgaagcgccaggcaccacccag
ctcgaggactaccgaaccgggcgcttcgatgtgcgggccttttcggcgcggaagtttcca
gagcgcttcgaccagggcgggatggcccttgccatcggccatccgctcaatgatcaattg
cggcttccctgtccggtgctctcctgcctcgctatcgcgttcgggtcgaaggagagctcg
aacgatctcgcggcggcgaagttcgggcgggcggagcagcaggccgcgaccaatatggtc
cgcttcctgcccgagctcaaagacaaggctgacgactggaaatgggtccgcgagcgggtg
cgcgatggcgcaaggctcgtgcgcgccggatctttcctgatcatggtggcacccgaaggc
gaggccgaagccgccgagcgggccgtccgctccctctatcgcggtatggggtgggaactc
gccaaggaccggttcgtcgccacccagaccctgggcgcctgtctgcccctgaccctagcc
gacgggctcggcgcggaccttcagaagcttcggcgtcttcgcttcatggtcaccgacacc
tgcgtccagattgcgccgctccagggcgaatatctcggtatgtccaccccggacctcatg
cttctggggcggcggggccagcccttcttctggtcgcccttcggcaatcagggggcgggc
aaccacaatgtcgcgatcatcggatcctccgggtccggcaaatcggtcctgatgcaggaa
ctggtgaccgggctgagaggcgcaggaaccaatgtcaccgtcatcgacgatggcgagagc
ttcaagcatatgtgcgaggcccttggcggacggcatgtgaagttcaccctcgaggctgat
gtctgcctcaacccattctcgctgctcgacgagcgaaaggcgaaggaagacggcgactac
gccaccgagagcctgaccctcgttcgcgccatgatcgaacagatggccaagggcgaggag
cgcgccacggccgaagagcggggtctcatcgacagtgccgtggccgaggtctggaaggcg
aggggcatcctcgccgggatcgacgatgtcgccgcggcactgaaggagcagggcgccgaa
ggggtgaagcttgccaacgcccttcgtccttacacgacggccgggctctacggccccttt
ttcaacggcgaggcgagcctcgtcatcgacaacccgctggcggttttcgagatgaaggat
ctcgaggccaagcccgaactgcgcgccgttgtcatgctggcgctcatgttcctgatcaat
cagcgcatgatggcggatcggcgcgagaagatggcgctggtgatcgacgaggcctgggcg
cttctcgggcgcggggctgccggagagttcatcgcggggttcgcccgtcgctgccgcaaa
tatggcggcgccatcatcaccggcacccaagggatcgacgactattaccgcaccgaaggg
gccaaggcagcctttgagaactccgactggtgcatcgtcctcaaactgaaacccgaggcg
attgctctggtcctcaaatccgagcgcctgtcgatcgacgcgcacaccgccgacatcatc
cgctccctgtcggtttccgcaggcgaatattccgaaatgctgatcatgggaccccatggc
cgccatgtgggccggctggtgctcgatcccttctcggcgacccttttctcgtccgatgcc
cggacctttgccgagatcgaggcgctggaagcccagggtctcacagtagcggaggccgtc
gagcgcgtcgccttccgccatcaagacaaggaggtgcgccatgccgcggagtga

DBGET integrated database retrieval system