KEGG   Plasmodium falciparum 3D7: PF3D7_0807300
Entry
PF3D7_0807300     CDS       T00095                                 

Definition
(RefSeq) ras-related protein Rab-18
  KO
K07910  Ras-related protein Rab-18
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pfa04131]
    PF3D7_0807300
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pfa04031]
    PF3D7_0807300
Membrane trafficking [BR:pfa04131]
 Others
  Rab GTPases of specific organelles
   Lipid droplets
    PF3D7_0807300
GTP-binding proteins [BR:pfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab12/18
    PF3D7_0807300
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU SRPRB TniB AAA_16 CPT
Other DBs
NCBI-GeneID: 2655310
NCBI-ProteinID: XP_001349449
PlasmoDB: PF08_0110
GeneDB: PF08_0110
UniProt: Q7K6B0
Position
8:join(381564..381627,381863..381928,382159..382297,382511..382847)
AA seq 201 aa
MKNKNKYDYLLKLLLVGDSSVGKSSILCRYSDNQFEEKVLSTIGIDFKVKYLKIDNKTIK
VGIWDTAGQERFRTLTSAYYRNAHAIILVYDCTVRESFENLDVWINEIDKYSTNKNAIKM
LVANKIDKPNHEVTKDEGKNFAFENNMLFCETSAKNDINITYCFEELIQQILNNPSLLEL
SIVTKNLKLGKKEESRSNCAC
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaaaataaaaataagtatgattatttactaaaattattattagtgggtgattccagc
gtaggaaagagtagtatattatgtagatactccgataaccaatttgaagagaaagtttta
tccacaataggtattgattttaaagtaaaatatttaaaaatcgataataaaacaataaaa
gtaggaatatgggatacggcaggtcaagaaagatttagaactttgacttctgcgtattat
agaaatgctcacgcaattattcttgtatacgattgtaccgttagagaatcctttgaaaac
ctagacgtttggattaacgagatagataaatattctaccaataaaaacgcgataaaaatg
cttgttgccaataaaattgataaacctaatcatgaagttacgaaagatgaaggaaaaaat
ttcgctttcgaaaataatatgctcttttgtgaaaccagtgcaaaaaatgatattaatata
acttactgttttgaagaattaatacaacaaattttaaataatccatctttgttagagtta
agtattgtaaccaaaaatttaaaacttggaaagaaagaggaaagccgatccaattgcgct
tgttaa

DBGET integrated database retrieval system