KEGG   Polymorphum gilvum: SL003B_p0041
Entry
SL003B_p0041      CDS       T01458                                 
Name
(GenBank) Type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pgv  Polymorphum gilvum
Pathway
pgv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SL003B_p0041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pgv02044]
    SL003B_p0041
Enzymes [BR:pgv01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SL003B_p0041
Secretion system [BR:pgv02044]
 Type IV secretion system
  Trb secretion system protein
   SL003B_p0041
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 ABC_tran AAA_29 ATPase_2 AAA_23 DUF87 AAA_21 TrwB_AAD_bind AAA_16 FtsK_SpoIIIE CbiA ATG17_like T2SSE
Other DBs
NCBI-ProteinID: ADZ72802
UniProt: F2J747
Position
pSL003B:complement(52349..54817)
AA seq 822 aa
MVALKSFRHSGPSFADLVPYAGLVDNGIILLKDGSLMAGWYFAGPDSESSTDAERNEVSR
QINAILSRLGSGWMIQVEAIRVPTGDYPTEDDCHFPDPVTRAIDAERRAHFQKERGHFES
RHALILTWRPPEPRRSGLTRYVYSDAGSRSATYADKALDSFQTSIREVEQYLANVVSIRR
MMTRETSERGGFRVARYDELFQFIRFCITGENHPVRLPEIPMYLDWLVTAELQHGLTPLV
ENRFLGIVAIDGLPAESWPGILNSLDLMPLTYRWSSRFVFLDAEEARAKLERTRKKWQQK
VRPFFDQLFQTQSRSVDQDAMLMVAETEDAIAEASSQLVAYGYYTPVIVLFDEQQARLQE
KCEAVRRLIQAEGFGARIETLNATDAFLGSLPGVSYANIREPLINTRNLADLIPLNSVWS
GTPVAPCPFYPPGSPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLALIAAQF
RRYSQAQVFAFDKGGSMLPLTLGLDGDHYQIGGDIGPSAEGEVRALAFCPLAELSTDGDR
AWASEWIETLVGLQGVTITPDYRNAISRQIGLMAESRGRSLSDFVSGVQMREIKDALHHY
TIDGPMGQLLDAEEDGLALGAFQCFEIEELMNMGERNVVPVLTYLFRRIEKRLTGAPSLI
ILDEAWLMLGHPVFRDKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKIC
LPNGAAREPGTREFYERIGFNERQIEIVATALPKREYYVVSPEGRRLFDMALGPVALSFV
GASGKEDLKRIRALHSEHGAAWPCPWLQQRGIAHAETFFPAK
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggttgccctcaagtcattccgtcattccggtccgtcctttgccgatctcgtgccctat
gccggcctggtcgacaacggtataatcctgctcaaggacggctcgctgatggccggctgg
tatttcgcggggccggacagcgagagctcgaccgacgccgagcgcaacgaggtgtcgcgg
cagatcaatgcaatcctgtcacggctcggctccggatggatgatccaggtcgaggccatc
agggttccgaccggagactatccgaccgaggacgattgccacttccccgatccggtcacg
cgggcgatcgacgccgaacgacgagcccatttccagaaggagagggggcatttcgagagc
cggcacgcgctgatcctgacgtggcggccgccggagccaaggcgctcaggcctgacgcgc
tatgtctattccgacgccggcagcaggtccgccacctatgccgacaaagcgctcgatagc
ttccagacctcgatccgcgaagtcgagcaatatctcgccaatgtcgtgtcgatccgccgg
atgatgacacgcgagacgtcagagcgcggcggcttccgggtcgcccgctatgacgagctg
tttcagttcatccgcttctgcatcaccggcgagaaccatccggtgcgcttgcccgaaatc
cccatgtatctcgactggctggtgacggccgagctgcagcacggtctcacccctttggtc
gaaaaccgctttctcggcatcgtggcgattgacggcctgccggcagaaagctggcccgga
atcctcaatagcctcgacctgatgccgctcacctatcgctggtcatcgcgcttcgtcttc
cttgatgccgaggaggcgagggcgaaactcgaacgcacccgcaagaaatggcagcagaaa
gtcaggcccttcttcgaccagcttttccagacgcaaagccgctcggtcgaccaggacgcc
atgctgatggttgccgagaccgaggacgcgattgccgaagcctcctcccagctcgtcgcc
tatggctattacacgcccgtgatcgtcctcttcgacgagcagcaggcgcgccttcaggaa
aaatgcgaggcggtccgccggctgatccaggccgaaggtttcggcgcacggatcgaaacg
ctgaatgcgaccgacgcctttctcggcagcctgccgggcgtctcctatgccaatatacgc
gagccgctgatcaacacccgcaatcttgccgacctcatcccgctgaactcggtttggtcg
ggcacccctgtcgcgccatgcccgttctatccgcctggctcgccgccgttgatgcaggtg
gccagtggctcgacgccgttccggctgaacctacatgtcgacgatgtcggacacacgctg
atcttcgggccgaccggttcggggaagtcgaccctgctggcgctgatcgccgcgcagttc
cggcgctacagccaggcccaggtctttgccttcgacaagggcggttcaatgctgccgttg
acgcttggtcttgatggcgatcactaccagatcggcggcgatatcggtccttcggcagaa
ggcgaagtgagggcgctggctttctgcccgcttgccgagctttcgaccgatggcgaccgc
gcgtgggcgtcggaatggatcgagaccctggtggggctgcagggtgtgaccatcaccccg
gactatcgcaacgccatctcccggcagatcgggctgatggcggaatcgcgtggccgttcg
ctctcggatttcgtgtcgggcgtgcagatgcgcgagatcaaggacgcgctgcatcactac
accatcgacggacctatgggtcagctgctcgatgccgaggaagacggtctggcgctcggc
gcttttcagtgcttcgagatcgaggaactcatgaacatgggcgaacgcaatgtcgtgccc
gtcctcacctacctcttccgtcgcatcgaaaagcgcctgaccggcgcacccagcctgatc
attctcgacgaggcctggctgatgctcggccacccggtgtttcgcgacaagatccgcgaa
tggctgaaggtgttgcgaaaggccaattgcgccgtcgtgctcgccacccagtcgatctcg
gacgcggagcgctccggcattatcgatgtgctgaaggagagttgcccgaccaaaatctgc
ctgccgaatggggctgcccgggagcccggcacacgagagttctatgagcgcatcggcttc
aacgaacggcagatcgagatcgtcgcgacggcgcttccaaagcgcgaatactacgtcgtc
tcacccgagggccgcaggctcttcgacatggcgctcggtcccgtcgcgctctccttcgtc
ggggcatccggcaaggaagacctgaagcgcattcgtgctcttcattccgaacatggggcc
gcatggccttgtccttggctccagcaaagggggatcgcccatgccgaaacattcttcccg
gccaagtaa

DBGET integrated database retrieval system