KEGG   Pyrococcus horikoshii: PH0552
Entry
PH0552            CDS       T00014                                 
Symbol
PH0552
Name
(GenBank) 163aa long hypothetical protein
  KO
K07822  archaeal flagellar protein FlaC
Organism
pho  Pyrococcus horikoshii
Brite
KEGG Orthology (KO) [BR:pho00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pho02044]
    PH0552 (PH0552)
   02035 Bacterial motility proteins [BR:pho02035]
    PH0552 (PH0552)
Secretion system [BR:pho02044]
 Type II secretion system
  Archaeal flagellar protein
   PH0552 (PH0552)
Bacterial motility proteins [BR:pho02035]
 Flagellar system
  Archaeal flagellar assembly proteins
   PH0552 (PH0552)
SSDB
Motif
Pfam: FlaC_arch CENP-F_leu_zip Laminin_II DUF1664 LPP Sec34 MscS_porin Nup54 FPP FapA EzrA HMMR_N NYD-SP28_assoc Baculo_PEP_C Exonuc_VII_L IFT57 DUF6779 DUF1192 BLOC1_2 TolA_bind_tri COG5 Gp58 AAA_13 Tektin RmuC DUF4140 TPR_MLP1_2 DUF1917 DUF2203 CCDC22 Packaging_FI TSC22 MAD Mce4_CUP1 Seryl_tRNA_N DivIC DUF4094 DUF4618 Sec8_exocyst V-SNARE_C MapZ_EC1 Phage_GPO FAT Fez1 TssO ATG17_like ADIP MCPsignal ACR_tran DUF5798 DUF5082 SLX9 COG2 DUF3450 PI3K_P85_iSH2 DUF5660 Cob_adeno_trans Fib_alpha BTG Tht1 CALCOCO1 Nup88 GAS PspA_IM30 HIP1_clath_bdg DAHL Allexi_40kDa CorA bZIP_1 DUF4407 ATPase DUF2321 Occludin_ELL
Other DBs
NCBI-ProteinID: BAA29641
UniProt: O58287
Position
492880..493371
AA seq 163 aa
MIAMALDFLTSLFKKKEKEEERKEETFEEVTVEELESRVEEKQQNEQIEQIMERLNDIEN
DLPRVKISIDNIKKQIQEIREEIERLDKTIKDIMMLYEVVSQEINPFKEQLSQESSLSSE
IQELKKQIEELKMELAQVKNDIKVLAGYGVDLDSILYEVLAEV
NT seq 492 nt   +upstreamnt  +downstreamnt
gtgatagcgatggcccttgacttcctaacttcattattcaagaagaaggagaaggaggag
gaaaggaaggaagaaaccttcgaggaggtaacggttgaagaacttgagagcagggttgaa
gagaagcagcagaacgagcagatagagcagataatggagaggctcaacgacatcgagaac
gatctcccgagggttaagataagcatcgacaacataaagaagcagattcaagagatcagg
gaggagatagagaggctcgacaagacgataaaggacataatgatgctctacgaagtagtc
tctcaggagataaacccattcaaggagcaactaagccaggagtcatcgctaagtagtgaa
atccaagagctcaagaagcagatagaagagctgaagatggagctcgcccaagttaagaac
gacatcaaggtgctcgctggctacggtgtcgacttagattcgatcctctacgaggtgctg
gcggaggtgtga

DBGET integrated database retrieval system