KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM217810
Entry
Phum_PHUM217810   CDS       T01223                                 
Name
(RefSeq) ADP-ribosylation factor, putative
  KO
K07941  ADP-ribosylation factor 6
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:phu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Phum_PHUM217810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phu04131]
    Phum_PHUM217810
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phu04147]
    Phum_PHUM217810
   04031 GTP-binding proteins [BR:phu04031]
    Phum_PHUM217810
Membrane trafficking [BR:phu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    Phum_PHUM217810
  Arf GTPases and associated proteins
   Arf GTPases
    Phum_PHUM217810
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM217810
  Exosomal proteins of colorectal cancer cells
   Phum_PHUM217810
GTP-binding proteins [BR:phu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    Phum_PHUM217810
SSDB
Motif
Pfam: Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 6PF2K SpoOE-like
Other DBs
NCBI-GeneID: 8237625
NCBI-ProteinID: XP_002425743
VectorBase: PHUM217810
UniProt: E0VHZ9
AA seq 175 aa
MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMREAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNHKL
NT seq 528 nt   +upstreamnt  +downstreamnt
atgggaaaacttttgtcaaaaattttcggcaacaaagagatgagaatattgatgctgggt
ctggatgctgctggaaaaacaactattttatacaagttgaagttgggacaatcagtgacc
acaatacccacagtaggatttaatgtagaaaccgttacatataaaaatgttaaatttaac
gtttgggatgtaggagggcaagataaaattcgacctctttggcggcattactacacgggt
actcaaggtttgatatttgttgttgattgtgccgatagagatagaatcgatgaagcaaga
caagaattacataggataataaatgatagagaaatgagagaagctataatacttatattt
gccaacaaacaggatcttcctgatgctatgaaaccgcatgaaatacaagaaaaattagga
ctgactcgaataagagacagaaattggtacgttcaaccatcttgtgctacaacaggggat
ggcctttacgagggtctaacttggttaacgtccaatcacaagttataa

DBGET integrated database retrieval system