KEGG   Pan paniscus (bonobo): 100968111
Entry
100968111         CDS       T02283                                 

Gene name
PSMC6
Definition
(RefSeq) proteasome 26S subunit, ATPase 6
  KO
K03064  26S proteasome regulatory subunit T4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03050  Proteasome
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100968111 (PSMC6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100968111 (PSMC6)
   05012 Parkinson disease
    100968111 (PSMC6)
   05014 Amyotrophic lateral sclerosis
    100968111 (PSMC6)
   05016 Huntington disease
    100968111 (PSMC6)
   05017 Spinocerebellar ataxia
    100968111 (PSMC6)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100968111 (PSMC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:pps03051]
    100968111 (PSMC6)
Proteasome [BR:pps03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     100968111 (PSMC6)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_22 AAA_2 RuvB_N AAA_18 AAA_33 Prot_ATP_OB_N DUF815 AAA_7 AAA_14 AAA_3 RNA_helicase TPR_MLP1_2 TIP49 IstB_IS21 Mg_chelatase AAA_11 TsaE Wtap AAA_24 ATPase AAA_25 NACHT AAA_28 AAA_19 Med4 DUF4140
Other DBs
NCBI-GeneID: 100968111
NCBI-ProteinID: XP_003831757
UniProt: A0A2R9AV98
Position
14
AA seq 403 aa
MAIPGIPYERRLLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSEND
LKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLT
IMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIP
PKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQ
PCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLD
PALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNV
CTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggccattcccggcatcccctatgagagacggcttctcatcatggcggaccctagagat
aaggcgcttcaggactaccgcaagaagttgcttgaacacaaggagatcgacggccgtctt
aaggagttaagggaacaattaaaagaacttaccaagcagtatgaaaagtctgaaaatgat
ctgaaggccctacagagtgttgggcagatcgtgggtgaagtgcttaaacagttaactgaa
gaaaaattcattgttaaagctaccaatggaccaagatatgttgtgggttgtcgtcgacag
cttgacaaaagtaagctgaagccaggaacaagagttgctttggatatgactacactaact
atcatgagatatttgccgagagaggtggatccactggtttataacatgtctcatgaggac
cctgggaatgtttcttattctgagattggagggctatcagaacagatccgggaattaaga
gaggtgatagaattacctcttacaaacccagagttatttcagcgtgtaggaataatacct
ccaaaaggctgtttgttatatggacctccaggtacgggaaaaacactcttggcacgagcc
gttgctagccagctggactgcaatttcttaaaggttgtatctagttctattgtagacaag
tacattggtgaaagtgctcgtttgatcagagaaatgtttaattatgctagagatcatcaa
ccatgcatcatttttatggatgaaatagatgctattggtggtcgtcggttttctgagggt
acttcagctgacagagagattcagagaacgttaatggagttactgaatcaaatggatgga
tttgatactctgcatagagttaaaatgatcatggctacaaacagaccagatacactggat
cctgctttgctgcgtccaggaagattagatagaaaaatacatattgatttgccaaatgaa
caagcaagattagacatactgaaaatccatgcaggtcccattacaaagcatggtgaaata
gattatgaagcaattgtgaagctttcggatggctttaatggagcagatctgagaaatgtt
tgtactgaagcaggtatgttcgcaattcgtgctgatcatgattttgtagtacaggaagac
ttcatgaaagcagtcagaaaagtggctgattctaagaagctggagtctaaattggactac
aaacctgtgtaa

DBGET integrated database retrieval system