KEGG   Pan paniscus (bonobo): 100995642
Entry
100995642         CDS       T02283                                 

Gene name
RHOA
Definition
(RefSeq) ras homolog family member A
  KO
K04513  Ras homolog gene family, member A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04062  Chemokine signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04144  Endocytosis
pps04150  mTOR signaling pathway
pps04270  Vascular smooth muscle contraction
pps04310  Wnt signaling pathway
pps04350  TGF-beta signaling pathway
pps04360  Axon guidance
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04611  Platelet activation
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04660  T cell receptor signaling pathway
pps04670  Leukocyte transendothelial migration
pps04722  Neurotrophin signaling pathway
pps04810  Regulation of actin cytoskeleton
pps04921  Oxytocin signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps04972  Pancreatic secretion
pps05100  Bacterial invasion of epithelial cells
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05152  Tuberculosis
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100995642 (RHOA)
   04015 Rap1 signaling pathway
    100995642 (RHOA)
   04310 Wnt signaling pathway
    100995642 (RHOA)
   04350 TGF-beta signaling pathway
    100995642 (RHOA)
   04072 Phospholipase D signaling pathway
    100995642 (RHOA)
   04071 Sphingolipid signaling pathway
    100995642 (RHOA)
   04024 cAMP signaling pathway
    100995642 (RHOA)
   04022 cGMP-PKG signaling pathway
    100995642 (RHOA)
   04150 mTOR signaling pathway
    100995642 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100995642 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100995642 (RHOA)
   04520 Adherens junction
    100995642 (RHOA)
   04530 Tight junction
    100995642 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100995642 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100995642 (RHOA)
   04621 NOD-like receptor signaling pathway
    100995642 (RHOA)
   04625 C-type lectin receptor signaling pathway
    100995642 (RHOA)
   04660 T cell receptor signaling pathway
    100995642 (RHOA)
   04670 Leukocyte transendothelial migration
    100995642 (RHOA)
   04062 Chemokine signaling pathway
    100995642 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100995642 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    100995642 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100995642 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    100995642 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100995642 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    100995642 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995642 (RHOA)
   05206 MicroRNAs in cancer
    100995642 (RHOA)
   05205 Proteoglycans in cancer
    100995642 (RHOA)
   05203 Viral carcinogenesis
    100995642 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100995642 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100995642 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100995642 (RHOA)
   05135 Yersinia infection
    100995642 (RHOA)
   05133 Pertussis
    100995642 (RHOA)
   05152 Tuberculosis
    100995642 (RHOA)
   05100 Bacterial invasion of epithelial cells
    100995642 (RHOA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995642 (RHOA)
   05418 Fluid shear stress and atherosclerosis
    100995642 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100995642 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100995642 (RHOA)
   04031 GTP-binding proteins [BR:pps04031]
    100995642 (RHOA)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    100995642 (RHOA)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100995642 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   100995642 (RHOA)
  Exosomal proteins of colorectal cancer cells
   100995642 (RHOA)
  Exosomal proteins of bladder cancer cells
   100995642 (RHOA)
GTP-binding proteins [BR:pps04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    100995642 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA VASP_tetra
Other DBs
NCBI-GeneID: 100995642
NCBI-ProteinID: XP_003818417
UniProt: A0A2R9AHH0
Position
3
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system