KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0859
Entry
PSPTO_0859        CDS       T00118                                 
Name
(GenBank) conserved hypothetical protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB
Motif
Pfam: TraC_F_IV AAA_22 FtsK_SpoIIIE P-loop_TraG DUF87 AAA_10 AIG1 AAA_7 TrwB_AAD_bind T2SSE AAA_29
Other DBs
NCBI-ProteinID: AAO54394
UniProt: Q889A2
Position
complement(929071..931740)
AA seq 889 aa
MLLEDGKSLAAFYELTPIGTEGRDPEWLRKARDALENALQDSFDELDESPWVVQFYARDE
TSWADYLETLHDYVQPRAQGTAFTEMYLQQFKHHLEAISKPGGLFEDTKVSQLPWRGQQR
RVRMVVYRRCTGDGLVRGQTPSMYLKNICERLTGGLANAGIKTRRMDRHDIRHWLLHWFN
PHPEHLGSKRQDIDRFFEIVNNRKVEPPEEGTLPLASGDDFSQCLFYSEPQSDAKKGLWY
FDSRPHRVIVLDRLRDAPKTGHLTGENRKGGDALHALFDKLPEDTVLNITLVITPQDVLE
AHLEKLARKSVGDNQASALTREAVDEARKLIGRKHKLYRGNVVFYLTGKDEQQLESRSME
LANAMLSAGMEPVYPRDEVAPLSSYLRWLPASFDVNKKHALDWYTQMMLAQHVANLSPVW
GRASGTGNPGITLFNRGGAPLTFDPFNKLDRQMNAHLLLFGPTGSGKSATANNLLMQLIA
IYRPRLFIIEAGNSFGLLGDFAQKLGLTVNRLKLAPGSGVSLAPFTDAIRLVSTPDKVTI
LDADDIEGSDEHLQTMPEQGEEERDVLGEMEIVARLMITGGEEREEARLTRADRSAIRHC
ILTAARTCFDAERAVKTEDVRDALSDAGKDTTLPEKRRERMFEMAEAMDMFCMGADGEMF
NREGTPWPEADITILDLATYAREGYNAQLSVAYISLINTVNNIAERDQFKGRPIVNFTDE
GHIITKNPLLSPYVIKITKMWRKLGAWFWLATQNIDDLPSAAAPMLNMIEWWICLNMPPD
EVEKITTFRKLTPAQKSLMLSARKESGKYTEGVVLSKSMEVLFRAVPPSLLLALAMTEPE
EKKQRYDLMQSLGVDELGAAIAIAHDLDRIRGIEPTTITFPASPLENLA
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgctgctcgaggacggcaagtcactggcagcattctatgaactcacccccatcggcacc
gaaggtcgggatcctgagtggttacgcaaagcgcgcgatgctctcgaaaatgcgctgcag
gacagttttgacgaactggatgaatcgccttgggtggtgcagttctacgccagggatgaa
accagttgggcagattatctggagacgttgcatgattacgtccagcctcgcgctcagggt
acggcgtttacagaaatgtacctgcagcaattcaaacatcacctagaggcaatctccaag
ccgggaggtttatttgaagacaccaaagtgtctcaactgccctggcgcggacagcaacgc
agggttcgcatggtcgtctaccggcgctgcaccggcgatggactggttcgtggccagacg
ccgtcgatgtacttgaaaaacatttgcgagcgtctgacgggaggactggccaacgcgggc
atcaaaacccggcgcatggatcgccatgacattcgtcactggctgttgcactggttcaac
ccgcatcccgaacacttgggatcaaagcgccaggacatcgatcgtttcttcgaaatcgtc
aataaccgcaaggtcgaaccaccagaagagggcacgctgccgctggccagcggcgatgat
ttctctcagtgcctgttttacagcgaaccgcaatcggatgccaagaaaggtctctggtac
ttcgactcgcgccctcatcgggtcatcgtcctcgatcgcttacgcgatgcgccaaagacc
gggcacctgacgggtgaaaaccgtaaaggcggggacgcgctgcatgccttgttcgacaag
ttgcccgaagacacggtactcaacatcacgctggtgatcactccccaggatgttctggag
gcccacctggaaaaactggcacgtaaatcagtcggtgacaatcaagcctccgccctgacc
cgtgaagcggtcgacgaagcccggaaactgatcggtcgaaaacacaagctgtaccggggc
aacgtggttttttacttgaccggcaaggatgagcaacaactggaaagtcggagcatggag
cttgccaatgccatgcttagcgccggtatggaacctgtctatcctcgtgatgaagtcgcc
cctctcagcagttacctgcggtggctgcccgccagttttgatgtgaacaagaaacatgct
ttggactggtacacgcagatgatgctcgcccagcatgtcgcgaacctttcgccagtatgg
gggcgtgccagcggcacgggcaaccccggcataaccctgttcaacaggggcggtgcaccg
ctgacgttcgacccattcaacaagcttgatcggcagatgaatgcccatctgctcctgttt
ggcccgacaggttcaggtaagtcagccacggccaacaatttgctgatgcagttaatcgcc
atttacaggccgcgcctgttcatcattgaagccggtaatagtttcggcctactgggagat
tttgcccaaaagcttgggctgacggtcaaccggctcaagttggcgccagggtcgggcgtg
agtctggcccccttcactgatgccattcgcctggtgtcaacacctgacaaagtcacgatc
ctggatgccgatgacattgaaggatccgatgagcatctgcaaacaatgcctgaacagggc
gaagaggagcgtgatgttttgggcgaaatggagatcgtagccaggctcatgatcaccggc
ggcgaagagagagaagaggctcgactcactcgcgcagaccgcagcgccattaggcactgc
attctgacggcagccagaacatgctttgacgctgaacgagcagtcaagacggaggatgtg
cgtgatgcgctgagtgacgctggcaaggacaccacccttccggaaaagcgccgagaacgc
atgtttgagatggctgaagccatggacatgttctgcatgggggctgacggtgagatgttc
aaccgggagggtacgccttggcctgaggccgacatcacaatcctggacttggccacctac
gcccgcgaggggtataacgcccaactgtcggtcgcctacatctcgctgatcaacaccgtg
aacaacattgcagaacgggaccaattcaaggggcgtccgatcgtcaacttcactgacgag
ggtcacatcattacgaaaaacccccttctctcgccctacgtcatcaagatcaccaagatg
tggcgaaaactcggggcctggttctggcttgccactcagaacatcgacgaccttccgtca
gcagcagcaccgatgcttaacatgatcgagtggtggatctgcctgaacatgccaccggat
gaagtggagaaaatcaccacgttccgtaagctgacgcccgcgcaaaagtcactgatgctg
tcagcccgtaaagagagcggaaagtatactgaaggggttgtgctttccaaatcgatggag
gttttgtttcgagccgtgcccccaagcctgctcctggcattggccatgactgagccggaa
gaaaaaaaacagcggtacgatctaatgcagtcgttaggggtagacgagctgggagccgca
atagcgatcgcacacgacctcgaccgcattcgcgggattgaaccgacaaccattacattc
cccgcttcgcccttggagaacctggcatga

DBGET integrated database retrieval system