KEGG   Rattus norvegicus (rat): 100361891Help
Entry
100361891         CDS       T01003                                 

Gene name
Rab5al1
Definition
(RefSeq) Rab5a, member RAS oncogene family-like 1
  KO
K07887  Ras-related protein Rab-5A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05146  Amoebiasis
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100361891 (Rab5al1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100361891 (Rab5al1)
   04145 Phagosome
    100361891 (Rab5al1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100361891 (Rab5al1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100361891 (Rab5al1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100361891 (Rab5al1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100361891 (Rab5al1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    100361891 (Rab5al1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    100361891 (Rab5al1)
   04031 GTP-binding proteins [BR:rno04031]
    100361891 (Rab5al1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    100361891 (Rab5al1)
 Endosome - Lysosome transport
    100361891 (Rab5al1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100361891 (Rab5al1)
  Exosomal proteins of other body fluids (saliva and urine)
   100361891 (Rab5al1)
  Exosomal proteins of colorectal cancer cells
   100361891 (Rab5al1)
  Exosomal proteins of bladder cancer cells
   100361891 (Rab5al1)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100361891 (Rab5al1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16 MCR_beta BrnT_toxin
Motif
Other DBs
NCBI-GeneID: 100361891
NCBI-ProteinID: XP_003751425
RGD: 2319287
UniProt: M0RC99
Position
14q21
AA seq 215 aa AA seqDB search
MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFSRAKNWVKELQR
QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTPMNVNEIFMAIAKK
LPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag
ttcaaactggtacttctaggagagtctgctgttggcaaatcaagtctggtgcttcgcttt
gtgaaaggccaatttcatgagtttcaagagagtaccattggggctgcctttctaacccaa
actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggccaagaa
cggtatcatagcctagcaccaatgtactaccgaggagcacaagccgccatagttgtgtat
gatattacaaatgaggagtccttttcgagagcaaaaaactgggttaaagaacttcaaagg
caagcgagtcctaatattgtgatagctttgtcaggaaacaaggctgacttagcaaataaa
agagctgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg
gagacatcagctaagacaccaatgaatgtaaatgaaatatttatggcaatagctaaaaag
ctgccaaagaacgaaccacaaaatccaggcgcaaactcagccagaggacgaggagtagac
cttactgagcctgcacagccagccagaagccagtgttgtagtaactga

DBGET integrated database retrieval system