KEGG   Rattus norvegicus (rat): 171058
Entry
171058            CDS       T01003                                 

Gene name
Rab3c
Definition
(RefSeq) ras-related protein Rab-3C
  KO
K07883  Ras-related protein Rab-3C
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171058 (Rab3c)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    171058 (Rab3c)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    171058 (Rab3c)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    171058 (Rab3c)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 GTP_EFTU Gtr1_RagA DUF2757 Septin AAA_16
Other DBs
NCBI-GeneID: 171058
NCBI-ProteinID: NP_598220
RGD: 620923
Ensembl: ENSRNOG00000011623
UniProt: P62824
Position
2
AA seq 227 aa
MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFV
STVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNA
VQDWSTQIKTYSWDNAQVILVGNKCDMEDERVVSTERGRHLGEQLGFEFFETSAKDNINV
KQTFERLVDIICDKMSESLETDPAITGAKQSTRLKETPPPPQPNCGC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagacacgaggcgcccatgcagatggcctcggcacaagatgccaggtttggtcagaaa
gactcttctgaccagaacttcgactacatgttcaagttgctgatcattggcaatagcagc
gtgggcaaaacatccttcctgttccgctatgctgatgactccttcacgtctgcctttgtc
agcacggtcggcatcgatttcaaagtaaaaactgtcttcaaaaatgaaaagagaatcaag
cttcagatttgggacacagcaggccaggaaagatacaggaccatcaccacagcctattat
cgaggggccatgggcttcattttaatgtatgacatcacaaatgaagaatccttcaacgct
gtacaagattggtcaactcagatcaaaacatattcctgggataatgcccaggttatactg
gtcggaaacaaatgtgacatggaagacgaacgggtggtctcaactgagagagggcgccac
ttaggagagcagctcgggtttgagttttttgaaaccagcgccaaggataacatcaacgtg
aagcaaacctttgagcgcctcgtagatatcatctgtgacaaaatgtcagagagcttggag
actgacccagccatcacaggcgccaagcagagcacgaggctcaaggaaacccctcctcca
ccacagcccaactgtggctgctaa

DBGET integrated database retrieval system