KEGG   Rattus norvegicus (rat): 171111
Entry
171111            CDS       T01003                                 

Gene name
Rab26
Definition
(RefSeq) RAB26, member RAS oncogene family
  KO
K07913  Ras-related protein Rab-26
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171111 (Rab26)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    171111 (Rab26)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    171111 (Rab26)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab26/37
    171111 (Rab26)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 SRPRB AAA_16 PduV-EutP PolyA_pol_arg_C AAA_22
Other DBs
NCBI-GeneID: 171111
NCBI-ProteinID: NP_598264
RGD: 620890
UniProt: P51156
Position
10q12
AA seq 190 aa
MLVGDSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGMKVKLQIWDTAGQERF
RSVTHAYYRDAHALLLLYDITNKDSFDNIQAWLTEIQEYAQQDVVLMLLGNKVDSTQERV
VKREDGEKLAKEYGLPFMETSAKSGLNVDLAFTAIAKELKQRSTKAPSEPRFRLHDYVKR
EGRGVSCCRL
NT seq 573 nt   +upstreamnt  +downstreamnt
atgctggtgggggattccggtgtggggaagacgtgcctgctcgtgcgcttcaaggatggg
gccttcctggctggtaccttcatctccactgtgggcatcgacttccggaataaagttctg
gatgtggatggcatgaaggtgaagctgcagatctgggacacggctggtcaggagcggttc
cgaagtgtcacccatgcctactaccgggatgctcacgcactgttgctgctctacgacatc
accaacaaagattccttcgacaacatccaggcctggttgacagaaatccaggaatatgcc
cagcaggacgtggtgctcatgctgttggggaacaaggttgactctactcaagaacgagtg
gtaaagagggaagatggggagaaattagccaaggagtatgggctgccattcatggagacc
agcgccaagagcggcctcaatgtggacttggcttttacagccatagcaaaggagctgaaa
caaagatccaccaaggctcccagtgagccgcgcttcaggctgcatgactatgtgaagagg
gagggccgaggggtctcctgctgtcgactctga

DBGET integrated database retrieval system