KEGG   Rattus norvegicus (rat): 24891
Entry
24891             CDS       T01003                                 

Gene name
Abcb4, Mdr2, Pgy3
Definition
(RefSeq) ATP binding cassette subfamily B member 4
  KO
K05659  ATP-binding cassette, subfamily B (MDR/TAP), member 4 [EC:7.6.2.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    24891 (Abcb4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    24891 (Abcb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24891 (Abcb4)
Enzymes [BR:rno01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     24891 (Abcb4)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    24891 (Abcb4)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 Rad17 RsgA_GTPase G-alpha Zeta_toxin AAA_5 AAA AAA_29 AAA_7 DUF87 SbcCD_C APS_kinase AAA_15 AAA_14 AAA_30 DUF815 AAA_24
Other DBs
NCBI-GeneID: 24891
NCBI-ProteinID: NP_036822
RGD: 620248
Ensembl: ENSRNOG00000008012
UniProt: Q08201
Position
4q12
AA seq 1278 aa
MDLEAARNGTARRLDGDFELGSISNQSREKKKKVNLIGPLTLFRYSDWQDKLFMLLGTAM
AIAHGSGLPLMMIVFGEMTDKFVDNAGNFSLPVNFSLSMLNPGRILEEEMTRYAYYYSGL
GGGVLLAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEMGWFDIKGTTELNTRLTDDISK
ISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAITAILGLSTAVWAKILSTFSD
KELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKKIGIKKAISANISMGI
AFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFPNARGA
AYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQ
TVALVGNSGCGKSTTVQLLQRLYDPTEGTISIDGQDIRNFNVRCLREFIGVVSQEPVLFS
TTIAENIRYGRGNVTMDEIKKAVKEANAYDFIMKLPQKFDTLVGDRGAQLSGGQKQRIAI
ARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGF
EDGVIVEQGSHSELIKKEGIYFRLVNMQTSGSQILSEEFEVELSDEKAAGGVAPNGWKAR
IFRNSTKKSLKSSRAHQNRLDVETNELDANVPPVSFLKVLRLNKTEWPYFVVGTLCAIAN
GALQPAFSIILSEMIAIFGPGDDTVKQQKCNMFSLVFLGLGVHSFFTFFLQGFTFGKAGE
ILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNTAN
LGTGIIISFIYGWQLTLLLLSVVPFIAVAGIVEMKMLAGNAKRDKKEMEAAGKIATEAIE
NIRTVVSLTQERKFESMYVEKLHGPYRNSVRKAHIYGITFSISQAFMYFSYAGCFRFGSY
LIVNGHMRFKDVILVFSAIVLGAVALGHASSFAPDYAKAKLSAAYLFSLFERQPLIDSYS
REGMWPDKFEGSVTFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQL
LERFYDPMAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAKNIAYGDNSRVVSQ
DEIVRAAKEANIHPFIETLPQKYETRVGDKGTQLSGGQKQRIAIARALIRQPRVLLLDEA
TSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIDNGKVKEHGTHQQLLA
QKGIYFSMVNIQAGTQNL
NT seq 3837 nt   +upstreamnt  +downstreamnt
atggatcttgaggcagcaagaaacggaacagcgcggcgcctggacggcgactttgaacta
ggcagcatcagcaaccagagcagagaaaaaaagaagaaagtgaatttaattggcccgttg
acactgttccgatactctgattggcaggataaattgtttatgctcctgggcaccgccatg
gccatagctcacggatcaggtcttccccttatgatgatagtctttggagaaatgacagat
aagtttgtagataatgctgggaacttttccttgccagtgaatttttcattgtcaatgcta
aatccaggaagaattctggaagaagaaatgactagatatgcatactactattcgggacta
ggtggtggagttcttttggctgcctatatccaagtctccttctggactttggcagctggc
cgacaaataaggaaaatcaggcaaaaattttttcacgccatccttcgacaagaaatgggc
tggtttgatatcaagggcaccaccgaactcaacacgcggctgacagatgacatctccaaa
atcagtgaaggaattggtgacaaggttggaatgttctttcaagcaatagccacgtttttt
gcaggattcatagtggggttcatcagaggctggaaactcaccctcgtgatcatggccatc
accgccatcttggggctctctacagccgtttgggcaaagatactctcaacattcagtgac
aaagaactagctgcctatgcaaaagcaggtgccgtggcggaagaggctctgggagccatc
aggaccgtgatagctttcgggggccagaacaaagagctagaaaggtatcagaagcattta
gaaaatgccaaaaagattggaattaaaaaggctatctcggccaacatctccatgggcatt
gcctttttgttaatatatgcatcctatgcactggccttctggtatggatccactctggtt
atatcaaaagaatatacaattggaaatgccatgacagtgttcttctcaatcctcattggg
gccttcagtgtggggcaggctgccccctgtattgatgctttccccaatgctagaggagca
gcctatgtgatctttgacattattgataataatcctaaaattgacagtttttcagagaga
ggacacaagccagacagcatcaaaggaaatttggagttcagtgacgttcacttttcctac
ccatctcgggctaatatcaagatcttgaagggcctcaacctgaaggtgaagagcgggcag
acggtagccctggttggcaacagtggctgtgggaaaagcacaactgtccagctgctgcag
aggctctacgaccccacagagggtacgattagcatcgatgggcaggacatccggaacttt
aacgtcaggtgtctaagggaattcatcggcgtggtgagtcaagagccggtactgttctct
accacgattgctgaaaatatccgctatggccgtgggaatgtaacaatggatgagattaaa
aaagctgtcaaagaggctaatgcctatgacttcatcatgaaactgccacagaaatttgac
accctggttggtgacagaggggcgcagctgagcgggggacagaaacagaggatcgccatt
gctcgtgccttggtccgcaaccccaagatcctcctgctggacgaggccacgtcagccttg
gacacagaaagcgaagctgaggtgcaggccgctctggataaggccagagaaggccggacc
accatcgtgatagctcaccgactgtcaactgtccggaatgcagatgtcatcgctgggttt
gaggatggcgtcatcgtggagcaaggaagccacagtgagctgataaagaaggaagggatc
tacttcagacttgttaacatgcagacatcaggaagccagatcctgtcagaagaatttgaa
gttgagctaagtgatgaaaaggctgctggaggtgtggccccaaatggctggaaagcacgc
atatttaggaattctacgaagaaaagtctgaaaagttcacgggcgcatcaaaataggctg
gatgtggaaaccaatgaacttgatgcaaacgtgccaccagtgtcttttctgaaggtctta
agactgaataaaacagagtggccctactttgtggtggggacactctgtgccattgccaac
ggggccctccagccggcattctccatcatcctgtcagagatgatagctatctttggccct
ggggatgacacagtaaagcaacagaagtgtaacatgttctcgctggtcttcttgggccta
ggagtccactccttctttactttcttccttcagggtttcacattcgggaaagctggcgag
atcctcaccacaaggctccggtccatggccttcaaagcaatgctaagacaggacatgagc
tggtttgacgatcataaaaacagtactggtgccctctctacaagactcgccacagacgct
gcgcaggtccaaggagccacaggaaccaggttggctttaattgcacagaacacagccaac
cttggaacgggtattattatatcatttatttacggttggcaactgacacttctgctctta
tcagttgttccattcattgctgtagcgggaattgttgaaatgaaaatgttggctggcaac
gccaagagagataaaaaggagatggaagctgctggaaagattgcaacagaggcaatagaa
aatattcggactgttgtatccttgacccaagagagaaaatttgagtcaatgtatgttgaa
aaattacacggaccttacaggaattcagtgcggaaggctcacatctacggcatcactttt
agcatctcacaagcattcatgtacttttcttatgctggctgctttcgatttggttcttac
ctcattgtgaatggacacatgcgcttcaaggatgtcatcctggtgttctcagcaatcgtg
cttggtgcagtggctctaggacatgccagctcatttgctccagactatgcaaaagccaag
ctgtctgcagcatacttattcagtctgtttgaaagacaacctctgattgacagctacagc
agagaaggaatgtggccggataagtttgaaggaagcgtgacattcaatgaagttgtgttc
aattatcccacccgggccaatgtgccagtgcttcaggggctgagcctcgaggtgaagaag
gggcagaccctggccctggtgggcagtagtggctgcgggaagagcaccgtggtccagctg
ctcgagcgcttctacgaccccatggccggaacagtgctcctcgatggtcaggaagcaaag
aaactcaatgtccagtggctccgagctcaacttggcattgtgtcccaggagcccatcctg
tttgactgcagcatcgccaagaacatcgcctacggagacaacagccgtgtcgtgtctcag
gatgagattgtgagggcggccaaggaggccaacatccaccccttcattgagacactgccc
caaaagtatgaaacaagagtaggagacaaggggacacagctctctggaggccagaaacag
aggattgctatcgcccgagccctcatcagacagcctcgggtcctactgctggatgaagcc
acgtcggctttggacactgagagtgaaaaggtcgtccaggaagcgctggacaaagccagg
gaaggccgcacctgcattgtgatcgcgcaccgcctgtccaccatccagaacgcagacttg
atcgtggtgatcgacaacggcaaggtcaaggagcacggcacccaccagcagctgctggcc
cagaaaggcatctatttctccatggtcaacattcaagctggcacacagaacttatga

DBGET integrated database retrieval system