KEGG   Rattus norvegicus (rat): 25128Help
Entry
25128             CDS       T01003                                 

Gene name
Umod, THP
Definition
(RefSeq) uromodulin
  KO
K18274  uromodulin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25128 (Umod)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    25128 (Umod)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25128 (Umod)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  25128 (Umod)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida EGF_CA EGF_3 cEGF EGF hEGF FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 25128
NCBI-ProteinID: NP_058778
RGD: 3940
Ensembl: ENSRNOG00000015557
UniProt: P27590
Position
1q35
AA seq 644 aa AA seqDB search
MGQLLSLTWLLLVMVVTPWFTVAGANDSPEARRCSECHDNATCVLDGVVTTCSCQAGFTG
DGLVCEDIDECATPWTHNCSNSICMNTLGSYECSCQDGFRLTPGLGCIDVNECTEQGLSN
CHSLATCVNTEGSYSCVCPKGYRGDGWYCECSPGFCEPGLDCLPQGPSGKLVCQDPCNVY
ETLTEYWRSTDYGAGYSCDSDMHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPS
SREGIVSRTACAHWSDHCCLWSTEIQVKACPGGFYVYNLTEPPECNLAYCTDPSSVEGTC
EECGVDEDCVSDNGRWRCQCKQDFNVTDVSLLEHRLECEANEIKISLSKCQLQSLGFMKV
FMYLNDRQCSGFSERGERDWMSIVTPARDGPCGTVLRRNETHATYSNTLYLASEIIIRDI
NIRINFECSYPLDMKVSLKTSLQPMVSALNISLGGTGKFTVQMALFQNPTYTQPYQGPSV
MLSTEAFLYVGTMLDGGDLSRFVLLMTNCYATPSSNSTDPVKYFIIQDRCPHTEDTTIQV
TENGESSQARFSIQMFRFAGNSDLVYLHCEVYLCDTMSEQCKPTCSGTRYRSGNFIDQTR
VLNLGPITRQGVQASVSKAASSNLGFLSIWLLLFLSATLTLMVH
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggggcagctgctctctttgacctggctgctgctggttatggtggtaactccctggttc
actgtagctggagccaatgactcaccagaagcaagaaggtgttctgaatgccacgacaat
gccacctgtgtgttggatggggtggtcaccacatgctcctgccaggcaggcttcactgga
gatgggctggtgtgtgaggacatagatgagtgtgccaccccgtggactcacaactgctcc
aacagcatctgcatgaacacactgggctcctacgagtgctcctgtcaggatggctttcgt
ctgacgcctgggctgggctgcattgatgtgaatgagtgcacagagcaggggctcagtaac
tgtcattccctggctacctgtgtcaacacggaaggcagctactcatgcgtgtgtcccaag
ggctatagaggggatggttggtactgtgagtgctcccctggcttctgtgagccagggctg
gactgcttgcctcagggtcccagtggaaagctggtgtgccaagacccctgcaatgtctat
gaaaccctgactgagtactggcgcagcacagactatggtgccggctactcctgtgactca
gatatgcacggctggtaccggttcacaggccagggtggcgttcgcatggctgagacctgt
gtgcccgtactgaggtgcaacacggctgcacccatgtggctcaatggctcgcatccttcg
agcagagagggcattgtgagccgcacagcctgcgcacactggagcgaccactgctgcctg
tggtccacagagatccaggtgaaggcctgccctggtggcttctatgtttacaacttgaca
gagccccctgagtgcaatctggcttactgcaccgatcctagctccgtggaggggacttgc
gaagaatgcggggtagatgaagactgcgtatctgataacggcagatggcgctgccagtgt
aaacaggacttcaacgttacagatgtctccctcctggagcacaggctggagtgtgaggcc
aatgaaatcaagatatccctcagcaagtgccagctacagagtttgggctttatgaaggtc
ttcatgtacctgaatgacagacagtgctcaggcttcagtgagaggggtgaacgagactgg
atgtccatagtgactcctgccagggatggtccctgtgggacagtattgaggagaaatgaa
acccacgccacctacagcaacaccctctacctggcaagtgagatcatcatcagggatatc
aacatcagaatcaactttgaatgctcttaccctctggacatgaaagtcagtctgaagacc
tccctacagcctatggttagtgccttgaacatcagcttgggtgggacaggcaagttcact
gtgcagatggcactgttccagaaccctacctacacacagccctaccaaggtccttctgtg
atgctctccactgaggcttttctgtatgtgggcaccatgctggatgggggtgacttgtcc
cggtttgtactgctaatgaccaactgctatgccacacccagtagcaactccacggaccct
gtaaaatacttcattatccaggacagatgtccacatacagaagatacaaccattcaggtg
acagagaatggcgagtcctctcaggcccggttctctattcagatgttccggtttgcagga
aactccgaccttgtctaccttcactgcgaggtgtacctgtgtgacactatgagtgagcag
tgtaaacctacctgttctggtactagatatcgaagtgggaacttcatagatcagacccgt
gtcctgaacttgggtcccatcacacgacaaggtgtccaggcctcagtgtccaaggctgct
tccagcaacttggggttcctgagcatctggctgctgctgtttctctcagctactttgacc
ctgatggttcattga

DBGET integrated database retrieval system