KEGG   Rattus norvegicus (rat): 25531
Entry
25531             CDS       T01003                                 

Gene name
Rab3a
Definition
(RefSeq) ras-related protein Rab-3A
  KO
K07882  Ras-related protein Rab-3A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25531 (Rab3a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    25531 (Rab3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25531 (Rab3a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25531 (Rab3a)
   04031 GTP-binding proteins [BR:rno04031]
    25531 (Rab3a)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    25531 (Rab3a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   25531 (Rab3a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    25531 (Rab3a)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB MMR_HSR1 GTP_EFTU Gtr1_RagA CPT AAA_24 DUF2757 AAA_16 Septin
Other DBs
NCBI-GeneID: 25531
NCBI-ProteinID: NP_037150
RGD: 3528
Ensembl: ENSRNOG00000019433
UniProt: P63012
Structure
PDB: 
3RAB 1ZBD

Position
16
AA seq 220 aa
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcctcagccacagactctcgatatgggcagaaggagtcctcagaccagaacttcgac
tatatgttcaagatcctgatcattggtaacagcagtgtgggcaaaacctcattccttttc
cgctacgcagacgactcttttactccagcctttgtcagcactgtgggcatagacttcaag
gtcaaaaccatctaccgcaatgacaagaggatcaagctgcagatctgggacacagcagga
caagagcggtaccgaaccatcaccacagcctactaccggggcgccatgggcttcattcta
atgtatgacatcaccaatgaggagtccttcaatgcagtgcaggactggtccactcagatc
aaaacttactcatgggacaatgcccaggtgctgctggtggggaacaagtgcgacatggag
gacgagcgagtggtgtcctcagaacgaggccggcagctggccgaccacctgggctttgag
ttctttgaggccagcgccaaggacaacattaatgtcaagcagacctttgaacgtctggtg
gacgtgatctgtgagaagatgtcggagtccctagatactgcagaccctgcagtcacgggt
gccaagcagggcccacagctcaccgaccagcaggcaccacctcatcaggattgcgcctgc
tga

DBGET integrated database retrieval system