KEGG   Rattus norvegicus (rat): 288779
Entry
288779            CDS       T01003                                 

Symbol
Rab5b
Name
(RefSeq) ras-related protein Rab-5B
  KO
K07888  Ras-related protein Rab-5B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
rno05146  Amoebiasis
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    288779 (Rab5b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    288779 (Rab5b)
   04145 Phagosome
    288779 (Rab5b)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    288779 (Rab5b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    288779 (Rab5b)
   05152 Tuberculosis
    288779 (Rab5b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    288779 (Rab5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    288779 (Rab5b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    288779 (Rab5b)
   04031 GTP-binding proteins [BR:rno04031]
    288779 (Rab5b)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    288779 (Rab5b)
 Endosome - Lysosome transport
    288779 (Rab5b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   288779 (Rab5b)
  Exosomal proteins of other body fluids (saliva and urine)
   288779 (Rab5b)
  Exosomal proteins of colorectal cancer cells
   288779 (Rab5b)
  Exosomal proteins of melanoma cells
   288779 (Rab5b)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    288779 (Rab5b)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU AAA_16 MCR_beta
Other DBs
NCBI-GeneID: 288779
NCBI-ProteinID: NP_001073405
RGD: 1306489
Ensembl: ENSRNOG00000006130
UniProt: A1L1J8
Position
7
AA seq 215 aa
MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ
SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR
QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
LPKSEPQNPGGAAGRSRGVDLHEQAQQNKSQCCSN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgactagcagaagtacagccaggcccaatgggcagccccaggccagcaaaatatgccag
ttcaaattggtcctgctgggagaatctgcagtggggaagtcgagcctggtgttacgtttt
gtcaaaggacagttccatgaataccaggaaagtaccattggagcggccttcctcacccag
tcggtgtgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa
cgataccacagtttagcccccatgtactacaggggtgcccaggctgccatcgtggtctat
gatatcactaatcaggaaacgtttgcccgggcaaagacatgggtaaaggaactacagcgg
caagccagccctagcatcgtcattgccttggcagggaacaaagctgaccttgccaacaag
cgcatggtggagtatgaagaggctcaggcatatgcagatgacaacagcttattatttatg
gagacttcagctaagactgctatgaacgtgaatgatctcttcctggcaatagcaaagaag
ttgccaaagagtgaaccccagaatccagggggtgcagcaggccgaagtcggggcgtggat
cttcatgagcaggcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system