KEGG   Rattus norvegicus (rat): 300338
Entry
300338            CDS       T01003                                 

Gene name
Mmp1b
Definition
(RefSeq) interstitial collagenase B
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04657  IL-17 signaling pathway
rno04926  Relaxin signaling pathway
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05219  Bladder cancer
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    300338 (Mmp1b)
  09152 Endocrine system
   03320 PPAR signaling pathway
    300338 (Mmp1b)
   04926 Relaxin signaling pathway
    300338 (Mmp1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    300338 (Mmp1b)
  09162 Cancer: specific types
   05219 Bladder cancer
    300338 (Mmp1b)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    300338 (Mmp1b)
  09163 Immune disease
   05323 Rheumatoid arthritis
    300338 (Mmp1b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    300338 (Mmp1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    300338 (Mmp1b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     300338 (Mmp1b)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M10
   300338 (Mmp1b)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Metallopep Reprolysin_5 Reprolysin_4 Peptidase_M54 Reprolysin_3 DUF4953 Peptidase_M57
Other DBs
NCBI-GeneID: 300338
NCBI-ProteinID: XP_038938724
RGD: 1306843
Ensembl: ENSRNOG00000008881
Position
8
AA seq 460 aa
MLSLPLLLLLLATSSYSLPVSQDGAQQNVETVWKYLENLGEDMQAKNVDVKEVMDEKLRQ
MEQSFGLKVTGNSNSETPSAIKTPMCGVPDVTPYSITYNNTQWTKTHLTYSILNYTPHLP
RKVVEDAIERAFKVWSDVTPLTFERVFEEEGDIVLSFHQGDHGDLYSFNGSKSHFAHAFP
PGPGLGGDVHYDLDETWTNNSDNFNLFYVTAHELGHSLGLSHSKDEEALMFPSYTWNNKD
FVLNQDDISKIQALYGPSPNPIQPTDATPDPCSSGLTFDAITTYRGEVIFFKDRFYIRVI
SFLPKPLINVIDLIWPDLPSKIDAAYEASLVDELRFFKGNKVWAVQEQNVLRGFPTDIHS
FFGFPSSVTHIDAAVCEEETGKTYFFVDNMYWRYDENTRSMDPGYPRLIAEDFPGIDDKV
DDVFQKEDNFYFFHQSTQHIFNLQTRKIVDAPDSSSWFNC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgcttagccttcctttgctgttgcttctcttggctaccagctcatacagtctccctgtg
tctcaggatggagcccagcagaatgtggagacagtctggaaatacctggaaaacttgggt
gaagacatgcaagctaaaaacgtggatgtcaaggaggtgatggatgaaaagctgagacaa
atggagcagtcatttgggctgaaagtgacaggaaattcaaattctgaaaccccgagtgct
atcaagacacccatgtgtggggtgcctgatgtgaccccatattcaattacttataacaat
actcagtggaccaaaacacatctgacttacagcattttaaactacacaccacatttgcca
agaaaagttgtggaagatgccattgagagagcctttaaagtctggagtgatgtgacacca
ctaacattcgaaagggtctttgaggaggaaggagatattgtgctctccttccaccaagga
gaccatggtgacctttactcatttaatggatctaaatcccactttgcccacgcttttccg
ccaggcccaggtttggggggcgatgttcattatgatctggatgagacgtggaccaacaac
agtgacaatttcaacttgttctacgttacagctcatgaactgggccactcccttggactc
tcccattctaaggatgaagaggcactaatgttccccagttacacatggaacaataaagac
tttgtactaaaccaggacgatattagtaaaatccaggctttatatgggccttccccaaat
cctatccagccaacagatgccacaccagatccatgtagtagtggtctgacctttgatgct
ataacgacatatcggggggaggtgatattctttaaagacaggttctacattcgtgtaatt
agcttcctgccaaaacctttgatcaatgtgatagatcttatctggccagatttgccaagt
aaaattgatgctgcttatgaagctagtttggtagatgagctccgctttttcaaaggcaat
aaagtctgggctgttcaggaacagaatgtactgagaggattccccacagacatccacagc
ttctttggcttccctagcagtgtgacacacattgacgctgccgtttgtgaggaagagact
ggaaaaacatacttcttcgttgacaacatgtactggaggtatgatgaaaatacacggtcc
atggatccaggttaccctagattaatagcagaagactttcctggaattgatgataaagtt
gatgatgttttccagaaagaggataatttctatttctttcaccaatcaactcaacacatt
tttaacctccaaacaagaaaaattgttgatgcccctgattctagttcctggttcaactgc
taa

KEGG   Rattus norvegicus (rat): 300339
Entry
300339            CDS       T01003                                 

Gene name
Mmp1
Definition
(RefSeq) interstitial collagenase precursor
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04657  IL-17 signaling pathway
rno04926  Relaxin signaling pathway
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05219  Bladder cancer
rno05323  Rheumatoid arthritis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    300339 (Mmp1)
  09152 Endocrine system
   03320 PPAR signaling pathway
    300339 (Mmp1)
   04926 Relaxin signaling pathway
    300339 (Mmp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    300339 (Mmp1)
  09162 Cancer: specific types
   05219 Bladder cancer
    300339 (Mmp1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    300339 (Mmp1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    300339 (Mmp1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    300339 (Mmp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    300339 (Mmp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     300339 (Mmp1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M10
   300339 (Mmp1)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Metallopep Reprolysin_5 DUF4953 Reprolysin_4 Reprolysin_3 Peptidase_M54
Other DBs
NCBI-GeneID: 300339
NCBI-ProteinID: NP_001128002
RGD: 1307917
Ensembl: ENSRNOG00000032353
UniProt: B5DFD5
Position
8
AA seq 464 aa
MLSLPLLLLLLATSSYSFPVFQDGARQNVETVWKYLENYYNLGEDVQAKNVDAKEVMAEK
LRQMQQLFGLKVTGNSNSETLSAMRKPRCGVPDVAPYAITHNNPRWTKTHLTYSILNYTP
YLPKEVIENAIERAFKVWSDVTPLTFERVFEEEGDIVFAFYRGDHSDNNPFDGPEYGLAH
TFPPGPRLGGDVHYDLDETWTDNSDNFNLFYVTAHELGHSLGLTHSRDVGALMFPSYTWY
TEDFVLNQEDINRIQALYGPSPNPIQPTGATTPHPCDGDLTFDAITTFRGEVMFFKGRFY
IRVNKFMPEAELNLIGIIWPNLPGKLDAAYEVSMIDQVRYFKGNKVWVVREHTVLRGFPT
DIHSFFGFPSSVTHIDAAVCEEETGKTYFFVDNMYWRYDENTQSMDPGYPRLTAEDFPGI
DDKVDDVFQKGENFYFFHQSVQRRFSLRIRRVDDSRDSSTWFNC
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcttagccttcctttgctgttgcttctcttggctaccagctcatacagtttccccgtg
tttcaggacggagcccggcagaatgtggaaacagtctggaaatacctggaaaactactac
aacttgggtgaagacgtccaagctaaaaacgtggatgccaaggaggtgatggctgaaaag
ctgaggcaaatgcagcagttatttgggctgaaagtgacaggaaattcaaattctgaaacc
ctgagtgctatgaggaaacctaggtgtggggtgcctgatgtggccccatatgccattact
cacaacaatcctcgttggaccaaaacacatctgacttacagcattttaaactacacacca
tatttgccaaaagaagttatagaaaacgccatcgagagagcctttaaagtctggagtgat
gtgacaccactaacattcgaaagggtttttgaggaggaaggtgatattgtgttcgccttc
tacagaggagaccatagtgacaataacccatttgatggacctgaatatggacttgctcac
acattcccaccaggcccacgtttggggggcgatgttcattatgatctggatgagacgtgg
accgacaacagtgacaatttcaatttgttctatgttacggctcatgaactgggccactcc
cttggactcactcattctagagatgtaggagcactaatgttccccagctacacatggtac
actgaagactttgtgctaaaccaggaggatattaatcgcatccaggctttatatgggcct
tccccaaatcccatccagccaacaggtgcaacaacaccacatccatgtgatggtgatcta
accttcgacgctataactacgtttaggggagaggtgatgttctttaaaggcaggttctac
attcgtgtaaataagttcatgccagaagctgagctcaatttgataggtattatctggcca
aatctgccaggtaaacttgatgctgcttatgaagttagtatgatagatcaagtccgctat
ttcaaaggcaataaagtctgggttgttcgagagcatactgtactgagaggattccccaca
gacatccatagcttctttggcttccctagcagtgtgacacacattgacgctgccgtttgt
gaggaagagactggaaaaacatacttcttcgttgacaacatgtactggaggtatgatgaa
aatacacagtccatggatccaggttatcctagattaacagcagaagatttccctggaatt
gacgataaagttgatgatgttttccaaaaaggcgaaaatttctacttctttcaccaatca
gttcaacgcagatttagcctccgaataagaagagttgatgactcccgtgattctagtacc
tggttcaactgctaa

DBGET integrated database retrieval system