KEGG   Rattus norvegicus (rat): 300438
Entry
300438            CDS       T01003                                 

Gene name
Ldlr
Definition
(RefSeq) low-density lipoprotein receptor precursor
  KO
K12473  low-density lipoprotein receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04913  Ovarian steroidogenesis
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
rno04976  Bile secretion
rno04979  Cholesterol metabolism
rno05145  Toxoplasmosis
rno05160  Hepatitis C
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    300438 (Ldlr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    300438 (Ldlr)
   04925 Aldosterone synthesis and secretion
    300438 (Ldlr)
   04927 Cortisol synthesis and secretion
    300438 (Ldlr)
  09154 Digestive system
   04976 Bile secretion
    300438 (Ldlr)
   04979 Cholesterol metabolism
    300438 (Ldlr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    300438 (Ldlr)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    300438 (Ldlr)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    300438 (Ldlr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    300438 (Ldlr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    300438 (Ldlr)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    300438 (Ldlr)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF SGL EGF_CA EGF hEGF Gag_p24
Other DBs
NCBI-GeneID: 300438
NCBI-ProteinID: NP_786938
RGD: 2998
Ensembl: ENSRNOG00000009946
UniProt: P35952
Position
8
AA seq 879 aa
MSTADLMLRWAIALLLAAAGVAAEDSCGKNEFQCRDGKCIVSKWVCDGSRECPDGSDESP
ETCMSVTCRSGEFSCGGRVSRCIPDSWRCDGRTDCENGSDELDCSPKTCSLDEFRCQDGK
CISRQFVCDQDWDCLDGSDEAHCAATTCGPAHFRCNSSSCIPSLWACDGDRDCDDGSDEW
PQNCGGRDTAAEVVSSPCSSLEFHCGSSECIHRSWVCDGAADCKDKSDEENCAVTTCRPD
EFQCADGSCIHGSRQCDREHDCKDMSDELGCINVTQCDGPNKFKCHSGECISLDKVCNSA
RDCRDWSDEPIKECKTNECLDNNGGCSHICKDLKIGYECLCPSGFRLVDGHQCEDIDECQ
EPDTCSQLCVNLEGSFKCECRAGFHMDPHTRVCKAVGSIGFLLFTNRHEVRKMTLDRSEY
TSLIPNLKNVVALDTEVANNRIYWSDLSQRKIYSAVMDQGTSLSYDAIISGDLHAPDGLA
VDWIHGNIYWTDSVPGTVSVADTKGVRRRTLFREKGSRPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIYSLVTEDIQWPNGITLDLPSGRLYWVDSKLHSISSIDVNGGGRKTILE
DEKQLAHPFSLAIYEDKVYWTDVLNEAIFSANRLTGSDVNLVAKNLMSPEDIVLFHNVTQ
PRGVNWCEATVLPNGGCQYMCLPAPQISAHSPKFTCACPDGMLLAKDMRSCLPEVDTVPT
TQGTSTIGPVVTTSAAVSLKRKEDPSATRHKEDPSATRHKEDPSATSTSRQPGDTPELST
VESVTVSSQVQGDMAGRGDEVQRHGVGFLSIFLPIALVALLVFGAILLWRNWRLRNINSI
NFDNPVYQKTTEDEIHICRSQDGYTYPSRQMVSLEDDVA
NT seq 2640 nt   +upstreamnt  +downstreamnt
atgagcaccgcggatctgatgctacgctgggccatcgccctgctcctggctgctgctgga
gttgcagcagaagattcatgtggcaagaacgagttccagtgtagagacggaaaatgcatc
gtcagcaagtgggtgtgtgacggcagccgcgagtgcccggatggctccgatgagtcccct
gagacatgcatgtctgtcacctgtcgatccggtgagttcagctgtggaggccgcgtcagc
cgatgcattcctgactcctggagatgtgatgggcggaccgactgtgaaaatggctcggat
gaactagactgctcccccaagacgtgctccctggatgagttccgctgccaggatggcaag
tgcatctcccggcagtttgtgtgtgaccaagactgggattgcctggatggctctgacgag
gcccactgtgcggccaccacttgtggccctgctcacttccgctgcaactcctcttcctgc
atccccagcctgtgggcctgcgacggggaccgggactgtgacgatggctccgatgagtgg
ccgcagaactgcgggggccgagacacggccgctgaggtggtcagcagcccctgctcctcc
ctcgagttccactgtggcagtagtgagtgtatccatcgcagctgggtctgtgacggtgcg
gctgactgcaaggacaagtcggacgaggagaactgcgcggtgaccacctgccgacctgac
gaattccagtgtgcagatggctcctgtattcacggtagccgccagtgtgaccgtgaacat
gactgcaaagacatgagcgacgagcttggctgcatcaatgtgacccagtgcgatggccct
aacaaattcaagtgccacagtggggagtgcatcagcttggacaaggtgtgcaactccgcc
cgggactgtcgtgactggtcggatgagcccatcaaggagtgcaagaccaacgagtgcttg
gacaacaatggtggctgttcccacatctgcaaggacctcaagattggctatgagtgccta
tgtcccagcggtttccggttggtggacggccaccagtgtgaagatattgacgagtgtcag
gagccagacacctgcagccagctctgtgtgaacctggagggcagcttcaagtgcgagtgt
cgggccggcttccacatggaccctcacaccagggtctgcaaggctgtgggttccataggg
tttctgctcttcaccaaccgccatgaggtacgtaagatgaccctggaccgcagcgagtat
accagcctgatccccaacctgaagaatgtggtggcgctggacactgaggtggccaacaat
agaatttactggtctgacctgtcccagagaaagatctacagcgccgtgatggaccagggc
accagcttgtcctatgatgccatcatcagtggggacctgcacgcccctgacgggctggcg
gtagactggatccatggcaacatctactggacggattcagttccgggcactgtttccgtg
gctgacaccaagggtgtcaggaggagaactctgttccgagagaaagggtccagacccaga
gccatcgtagtggaccctgtgcatggcttcatgtactggacagattgggggacacctgcc
aagatcaagaaagggggtttgaatggtgtagacatctactctctggtgaccgaggacatc
cagtggccaaatggcatcacactagatcttcccagtggccgcctctattgggttgattcc
aaactccactccatctccagcatcgatgtcaatgggggtggtcggaaaaccattttggag
gatgagaagcagctagctcaccccttctccttggccatctatgaggacaaagtgtattgg
acagatgtcttaaatgaagccattttcagtgccaaccgcctcacgggttcagatgtgaat
ttggtggctaaaaacctcatgtccccggaggacattgtcctgtttcacaacgtcacgcag
cctagaggggtaaactggtgtgaggcaacggttctccccaacggtggctgccagtacatg
tgcctgcctgcccctcagatcagtgcccactcacccaagttcacctgcgcttgccctgat
ggtatgctactggccaaggacatgaggagctgcctcccagaagtcgacactgtaccgacc
acccaggggacatccaccattgggcctgtggtcaccacatcagctgctgtgtcactgaag
cgcaaggaggatccctcagctactaggcacaaggaggatccctcagctactaggcacaag
gaggatccctcagctaccagcacctctaggcagcctggggataccccagagctcagcaca
gtggagtcggtgacagtgtcctcccaagtccaaggtgacatggctggcagaggggacgag
gtgcagcggcacggtgtggggttcttgtccatcttcctccccattgcactggtggccctc
cttgtcttcggagccatcctcctgtggaggaactggcggctgaggaacattaacagcata
aactttgacaacccagtctaccagaagaccacggaggacgagatccacatttgccgcagc
caggatggctatacctacccctcgagacagatggtcagcctggaggatgatgtggcatga

DBGET integrated database retrieval system