KEGG   Rattus norvegicus (rat): 303559
Entry
303559            CDS       T01003                                 

Gene name
Arl4d, Arf4l
Definition
(RefSeq) ADP-ribosylation factor like GTPase 4D
  KO
K07945  ADP-ribosylation factor-like protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    303559 (Arl4d)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl4/Arl7
    303559 (Arl4d)
SSDB
Motif
Pfam: Arf Ras Roc SRPRB MMR_HSR1 G-alpha Gtr1_RagA GTP_EFTU NTPase_1 DUF3088 6PF2K
Other DBs
NCBI-GeneID: 303559
NCBI-ProteinID: NP_001100522
RGD: 1306875
Ensembl: ENSRNOG00000020770
UniProt: B2RZ70
Position
10q32.1
AA seq 201 aa
MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKI
RVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDSAETERLEEARMELHRIS
KASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQPGL
EHLYEMILKRKKAPRSSKKRR
NT seq 606 nt   +upstreamnt  +downstreamnt
atggggaaccacttgactgaaatggcacctacggcctcatcctttctgccacacttccag
gcactgcatgttgtggtcattgggttggattccgccgggaagacttcccttctttaccgc
ctcaagttcaaggaatttgtccagagcgtccccaccaagggctttaacaccgagaagatc
cgagtgcccctgggggggtcccgtgggatcactttccaagtgtgggatgttgggggtcag
gagaagcttcggccactgtggcgctcctacacccgccggacagatggactggtgtttgtg
gtggactccgcagagactgagcggttagaggaagctagaatggagctacaccggatcagc
aaggcttccgacaaccagggggtgccggtgctggtgctggccaacaagcaggaccagccg
ggggcactaagcgcagcggaggtggagaagaggctggcagtccgagagctggcagccgcc
acgctcacccacgtgcagggctgcagtgctgtggatgggctgggcctgcagccgggacta
gagcatttgtatgagatgatcctgaagaggaagaaggcaccccggtcgagcaagaagaga
cggtga

DBGET integrated database retrieval system