KEGG   Rattus norvegicus (rat): 315668Help
Entry
315668            CDS       T01003                                 

Gene name
Rab39a, Rab39
Definition
(RefSeq) RAB39A, member RAS oncogene family
  KO
K07924  Ras-related protein Rab-39A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    315668 (Rab39a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    315668 (Rab39a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 RsgA_GTPase SRPRB zf-C2H2_3
Motif
Other DBs
NCBI-GeneID: 315668
NCBI-ProteinID: NP_001101618
RGD: 1311286
Ensembl: ENSRNOG00000009008
UniProt: D3ZZP2
Position
8q24
AA seq 217 aa AA seqDB search
MEAIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGK
RIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQI
VFLLVGHKCDLASQRQVSREEAEKLSKDCGMKYIETSAKDATNVEESFTILARDIYELIK
KGDICIQDGWEGVKSGFVPNTVHSSEEAVKPRKQCFC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaggctatttggatctaccagttccgcctcatcgtgatcggtgactccacggtaggc
aagtcgtgccttctgcaccgcttcacccaaggccgcttcccagggctgcgctccccggcc
tgcgaccccacagtcggcgtggacttcttctcgcgcctcctggagattgagccaggcaag
aggatcaagctgcagctttgggacacggcggggcaggagcgattcagatcaataactcga
tcctattaccgcaactcagttggaggatttttagtgtttgacattactaaccgacggtct
tttgaacatgtgaaagattggctagaagaagcaaaaatgcatgtgcagccttttcagatt
gtatttctactggtgggacataaatgtgatctagcttcacaacgtcaggtttcaagggag
gaagctgagaaactgtcaaaggactgtggaatgaagtacatagaaacctcagcaaaggat
gccacgaatgttgaagagtcctttacaatcttggcaagagacatatatgaacttattaaa
aaaggagacatttgtattcaggatggatgggaaggggttaaaagtggtttcgttccaaat
actgtgcattcttctgaggaagcagtgaagcctagaaaacagtgcttctgttga

DBGET integrated database retrieval system