KEGG   Rattus norvegicus (rat): 317580Help
Entry
317580            CDS       T01003                                 

Gene name
Rab33a, RGD1563280
Definition
(RefSeq) RAB33A, member RAS oncogene family
  KO
K07919  Ras-related protein Rab-33A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    317580 (Rab33a)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    317580 (Rab33a)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab GTPases
    317580 (Rab33a)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    317580 (Rab33a)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab33
    317580 (Rab33a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 SRPRB GTP_EFTU G-alpha TniB PduV-EutP FeoB_N
Motif
Other DBs
NCBI-GeneID: 317580
NCBI-ProteinID: NP_001101727
RGD: 1563280
Ensembl: ENSRNOG00000006698
UniProt: D3ZCU8
Position
Xq36
AA seq 237 aa AA seqDB search
MAQPILGHGSLQPASAAGLASLELDSSMDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGT
FPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVT
KMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFET
SAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQTLEFPQEANSKTSCPC
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccatcctgggccatgggagcctgcagcccgcctcagctgctggcttagca
tccttggagctcgactcatcgatggaccagtacgtgcagattcgcattttcaaaatcatc
gtgattggggactccaacgtgggcaagacctgcctgaccttccgcttctgcgggggtact
ttcccagacaagactgaggccactatcggtgtggacttcagggagaagaccgtggaaatc
gagggcgagaagatcaaggttcaggtgtgggacacggcaggacaagaacgcttccgtaaa
agcatggttgagcattattaccgcaatgtgcatgcagtggtctttgtctatgacgtcacc
aagatgacctccttcaccaacttaaaaatgtggatccaggaatgcaatgggcatgctgtg
cccccgctagtcccaaaggtgcttgtgggtaacaagtgtgacttgagggaacagatccag
gtaccctccaacttagccctgaaatttgctgatgcccacaacatgctcttatttgagaca
tcagccaaggaccccaaagaaagccagaatgtggagtcaatcttcatgtgcctggcttgc
cgactgaaggcccagaaatccctcttgtaccgtgatgctgagaggcagcaaggaaaggtg
cagacactggagttcccacaggaagctaacagtaaaacttcctgtccttgttga

DBGET integrated database retrieval system