KEGG   Rattus norvegicus (rat): 353253
Entry
353253            CDS       T01003                                 

Gene name
Kir3dl1
Definition
(RefSeq) killer cell immunoglobulin-like receptor 3DL1 precursor
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno04650  Natural killer cell mediated cytotoxicity
rno05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    353253 (Kir3dl1)
   04612 Antigen processing and presentation
    353253 (Kir3dl1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    353253 (Kir3dl1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    353253 (Kir3dl1)
CD molecules [BR:rno04090]
 Proteins
  353253 (Kir3dl1)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Ig_4 V-set SID-1_RNA_chan Orf78 DUF4834 Sigma_reg_N Tmemb_9 Adeno_E3_CR1 OAD_gamma DUF5385 DUF5452 ASFV_J13L m04gp34like tRNA_anti-like DUF6377 PspB Amnionless SurA_N_2 DUF975
Other DBs
NCBI-GeneID: 353253
NCBI-ProteinID: NP_852144
RGD: 727836
Ensembl: ENSRNOG00000027843
UniProt: P83556
Position
1
AA seq 422 aa
MMFEFLSLLCSGFFLVQRMSAHMGSYDKPFLCASPSYIVPQGQNVTLICDSHSKPNIFKV
YKEDGFPILQLHEKTFTKSLDIGPVTPEYAGTYRCFHHQYPNEISAHSEPLKIIISGIYM
KPFLIAPQTPLANSGENVTLECHSEIMFDTYILTSHRMEILKETLQHFQESHFSGSYASF
TIGPMTPDHSGTYTCYGAYNHSLYEWSDSSDPVDIKITGEYKKPSLSSVMSPVLVSEQNM
TLSCISNHQFEMFHLSREGVPQGKGIPAMQSHSGKFEAKFLLSPVIQKGNYRCYGSFKNS
SHVWSSPSDPLYLPAKDNLKNLHIQIGLLVTMVLVIVVIIIIIIIIIIIIYYYYFSKKSS
ILEQESEVKATINRQDPERQEEHKVTYIEFEQRIFNKNLMPPISQSPKEFSIDTVVYTEV
MI
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgatgttcgagttcctaagcctactgtgttctggtttcttcctagtccagaggatgtca
gcacacatgggaagttatgataagccttttctctgtgcctcgccaagttatattgttcct
cagggacagaatgtgactcttatttgtgactctcatagtaaacctaacatattcaaggtg
tacaaagaagatgggtttcctatccttcagttacatgagaaaacattcacgaagagcctt
gacattggtcctgtaaccccagaatatgcaggcacctacagatgctttcatcatcaatac
cctaatgaaatttcagcgcatagtgaacctctgaagatcataatttcaggaatctacatg
aagcctttcctcatagctccacaaactcccctggcaaattcaggagagaatgtgaccctg
gagtgtcattcagagattatgtttgatacctacattttgacttcacacagaatggaaata
ctaaaagaaactttgcagcattttcaagaatctcattttagtgggtcttatgccagtttc
acaattggtcccatgacacctgatcacagtggaacatacacgtgctatggtgcttacaat
catagcttatatgagtggtcagactctagtgaccccgttgacatcaagatcacaggtgaa
tacaagaaaccttctctgtcgtctgtgatgagccctgtactggtgtcagaacagaacatg
accctgtcctgcatctctaaccatcagtttgaaatgttccatctgtccagagaaggggtg
cctcaaggaaaagggatacctgcaatgcagagccacagtggtaaatttgaagccaaattc
cttcttagtcctgtgatccaaaaagggaactatagatgctatggctctttcaaaaactct
tcccatgtgtggtcatctccaagtgaccccttgtaccttcctgccaaagataacctcaag
aacctgcacattcaaattgggctcttagtgaccatggtccttgtcatcgtcgtcatcatc
atcatcatcatcatcatcatcatcatcatttattattattacttttccaaaaagagcagc
attttagaacaagagtctgaagttaaagcaacaataaacagacaggatcctgaaagacaa
gaagagcataaggtgacatacatagaatttgagcagaggatcttcaacaaaaacttaatg
cctcctatttcccagagtcccaaggagttttctatagatactgttgtgtacacagaagtt
atgatatga

DBGET integrated database retrieval system